prot_L-elsbetiae_contig15528.3887.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NamemRNA_L-elsbetiae_contig15528.3887.1
Unique Nameprot_L-elsbetiae_contig15528.3887.1
Typepolypeptide
OrganismLaminarionema elsbetiae ELsaHSoW15 (Laminarionema elsbetiae ELsaHSoW15)
Sequence length954
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15528.3887.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 585..614
NoneNo IPR availableCOILSCoilCoilcoord: 497..531
NoneNo IPR availableGENE3D1.20.5.190coord: 778..819
e-value: 9.6E-8
score: 33.7
NoneNo IPR availablePANTHERPTHR46184FAMILY NOT NAMEDcoord: 529..635
coord: 782..868
coord: 168..252
coord: 35..117
coord: 434..516
coord: 353..435
coord: 282..368
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 716..738
e-value: 370.0
score: 0.7
coord: 439..461
e-value: 21.0
score: 11.0
coord: 138..160
e-value: 63.0
score: 7.1
coord: 527..549
e-value: 390.0
score: 0.5
coord: 184..206
e-value: 50.0
score: 7.9
coord: 346..368
e-value: 220.0
score: 2.6
coord: 799..821
e-value: 69.0
score: 6.8
coord: 739..761
e-value: 67.0
score: 6.9
coord: 230..252
e-value: 300.0
score: 1.5
coord: 640..662
e-value: 20.0
score: 11.2
coord: 115..137
e-value: 7.2
score: 14.9
coord: 299..321
e-value: 86.0
score: 6.0
coord: 323..345
e-value: 22.0
score: 10.8
coord: 609..631
e-value: 130.0
score: 4.4
coord: 485..507
e-value: 190.0
score: 3.2
coord: 663..685
e-value: 31.0
score: 9.6
coord: 35..57
e-value: 11.0
score: 13.3
coord: 392..414
e-value: 190.0
score: 3.2
coord: 276..298
e-value: 53.0
score: 7.7
coord: 929..951
e-value: 34.0
score: 9.3
coord: 58..80
e-value: 120.0
score: 4.6
coord: 550..572
e-value: 1.2
score: 18.1
coord: 776..798
e-value: 6.9
score: 15.0
coord: 462..484
e-value: 0.9
score: 18.6
coord: 822..844
e-value: 110.0
score: 5.2
coord: 415..437
e-value: 9.9
score: 13.7
coord: 845..867
e-value: 1.1
score: 18.2
coord: 573..595
e-value: 310.0
score: 1.3
coord: 880..902
e-value: 0.6
score: 19.1
coord: 207..229
e-value: 110.0
score: 5.1
coord: 369..391
e-value: 59.0
score: 7.3
coord: 253..275
e-value: 38.0
score: 8.8
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 847..865
e-value: 0.016
score: 14.9
coord: 883..902
e-value: 0.27
score: 11.1
coord: 187..204
e-value: 0.18
score: 11.7
coord: 933..948
e-value: 0.02
score: 14.6
coord: 418..435
e-value: 0.055
score: 13.3
coord: 118..134
e-value: 0.037
score: 13.8
coord: 38..56
e-value: 0.17
score: 11.8
coord: 553..572
e-value: 0.22
score: 11.4
coord: 780..797
e-value: 0.25
score: 11.2
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1..28
score: 7.236
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 720..746
score: 6.54
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 324..350
score: 7.437
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 489..515
score: 7.035
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 528..554
score: 6.559
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 440..466
score: 6.98
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 463..487
score: 8.425
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 664..693
score: 7.382
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 610..639
score: 7.547
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 881..910
score: 7.657
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 577..603
score: 6.778
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 846..875
score: 7.895
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 254..280
score: 7.035
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 59..88
score: 7.401
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 551..575
score: 8.334
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 823..849
score: 7.529
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 139..167
score: 6.742
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 641..669
score: 8.553
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 116..145
score: 8.407
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 777..803
score: 8.261
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 933..954
score: 6.852
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 36..65
score: 7.565
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 82..111
score: 7.364
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 418..445
score: 6.797
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 208..237
score: 7.382
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 233..260
score: 6.559

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
L-elsbetiae_contig15528contigL-elsbetiae_contig15528:445..4008 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on OGS1.02022-09-29
Diamond blastp: OGS1.0 vs UniRef902022-09-16
OGS1.0 of Laminarionema elsbetiae ELsaHSoW152021-02-24
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
mRNA_L-elsbetiae_contig15528.3887.1mRNA_L-elsbetiae_contig15528.3887.1Laminarionema elsbetiae ELsaHSoW15mRNAL-elsbetiae_contig15528 445..4008 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>prot_L-elsbetiae_contig15528.3887.1 ID=prot_L-elsbetiae_contig15528.3887.1|Name=mRNA_L-elsbetiae_contig15528.3887.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=954bp
LSAAVRLQSLARGVAGRRRAAAAREVRQMQVRAARENSAATAIQARWRLR
SARRRFSTARQAAVRIQSFARGSAEAAHYRRARAAIVAVQALQRGAGVRA
RLSRERAEKQAAAREEASAAVSLQAVCRGVLARARRRRRDAAATALQARV
RGVAGRTRAAGRRAAAAVLQRWGRVVSEELRFRGVVAAACVLQAWGRGVV
ARSRLAGRRAAAVRVQAWIRGVMGAGRFRRGLRAAVALQALQRGAVARAG
VTARHDAAARVQAAARGRRGVRLFRKKRAAAVCLQAWSRACAAREGLARR
QRAAVVVQAWSRAAAAGKRFRETRNAAAVAVQAWWRGAAAARRFRGLARA
AVVIQARARTVAAVARYRGAVGAATAIQSHWRRAVAVARYRRDVSAAVSI
QARWRASSGASRYRRIVAAVVAIQRAWRGTQARRRRLAQRGRGATDVQAW
WRMVTARARYRKQKSSAIRLQAAVRGTAARATYRRAIGGSVLLQALVRGA
QARARLEQERREAAELEAAALAARAREAARAAVAIQAWHRGAAAVACYRK
RKSSAIRLQAAVRGTAARAAYRQAIGGSVLLQALVRGAQARFRLEQERRE
AAELEAARAQEAAAVAVQAWHRGRAARKRRVQAEQAAAAARVAAAVRVQA
LVRGVAARRALRATAAAATFVQAYARGRRARGDLSRRRAAAVRIQSAARA
VSASAWVGRMREERRRALLASVAIQRAWRGAAARATLSRRTAAAVAVQRW
WRSQLEISRLATARAAAAAVAHQAALEQGAAVSLQACFRGRLVRAALRRE
AAAAVVVQARWRGLSGRAVAANRKASAVRVQALARGAVAAARYREARAAA
VVLQARWRGALARARLATEAEIWAEIQAAREESSARTLQAFARGVLARAE
LRRAAAAAAAVQGAWRRRRAGLQEERSRAVACAAVAVQAWWRMMVARVEG
RRAR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000048IQ_motif_EF-hand-BS