prot_L-elsbetiae_contig13469.2662.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13469.2662.1 vs. uniprot
Match: A0A6H5KXH0_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXH0_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 1.200e-15 Identity = 34/42 (80.95%), Postives = 40/42 (95.24%), Query Frame = 0 Query: 1 VKGVRLLDITFLRATGESSARGYPWHEALAWWQSGVRRHMLE 42 VKGV+LLD+ FLRATGESSA GYPWHEALA+W+SGVRRH+L+ Sbjct: 158 VKGVQLLDLAFLRATGESSAEGYPWHEALAFWKSGVRRHILD 199
BLAST of mRNA_L-elsbetiae_contig13469.2662.1 vs. uniprot
Match: D7G9B3_ECTSI (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9B3_ECTSI) HSP 1 Score: 77.4 bits (189), Expect = 1.640e-15 Identity = 33/42 (78.57%), Postives = 40/42 (95.24%), Query Frame = 0 Query: 1 VKGVRLLDITFLRATGESSARGYPWHEALAWWQSGVRRHMLE 42 +KGV+LLD+ FLRATGESSA GYPWHEALA+W+SGVRRH+L+ Sbjct: 141 IKGVQLLDLAFLRATGESSAEGYPWHEALAFWKSGVRRHILD 182 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13469.2662.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13469.2662.1 ID=prot_L-elsbetiae_contig13469.2662.1|Name=mRNA_L-elsbetiae_contig13469.2662.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bpback to top |