prot_L-elsbetiae_contig13284.2546.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13284.2546.1 vs. uniprot
Match: D7G977_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G977_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 8.750e-7 Identity = 29/48 (60.42%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 120 TSVMAVATRMRKAAGATHDPVDPYYVLVDLVVNGNPAPLAFRIPRKPA 167 T V +A +MR A A+HDP DP V VDL+VNG+PAPL FRIP K A Sbjct: 159 TRVEEIARKMRATAEASHDPADPASVFVDLLVNGDPAPLVFRIPPKKA 206
BLAST of mRNA_L-elsbetiae_contig13284.2546.1 vs. uniprot
Match: A0A6H5JC06_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC06_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 1.580e-6 Identity = 29/48 (60.42%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 120 TSVMAVATRMRKAAGATHDPVDPYYVLVDLVVNGNPAPLAFRIPRKPA 167 T V +A +MR A A+HDP DP V VDL+VNG+PAPL FRIP K A Sbjct: 115 TRVEEIARKMRATAEASHDPSDPASVFVDLLVNGDPAPLVFRIPPKKA 162 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13284.2546.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13284.2546.1 ID=prot_L-elsbetiae_contig13284.2546.1|Name=mRNA_L-elsbetiae_contig13284.2546.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=222bpback to top |