prot_L-elsbetiae_contig1310.2444.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1310.2444.1 vs. uniprot
Match: D7FTN3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTN3_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 7.920e-14 Identity = 35/52 (67.31%), Postives = 44/52 (84.62%), Query Frame = 0 Query: 29 VNSTNMSGATPLSCAIGGMGGEVGECAALLRAAGGVVRLVEETIAPGSIIDV 80 + +MSGATPLSCA+GG GG GECA LLRA+GG+VRLV++TI+ GSI+DV Sbjct: 46 IEGKHMSGATPLSCAMGGAGGPDGECATLLRASGGLVRLVKDTISSGSILDV 97
BLAST of mRNA_L-elsbetiae_contig1310.2444.1 vs. uniprot
Match: M2RK87_TREDN (Uncharacterized protein n=1 Tax=Treponema denticola US-Trep TaxID=999440 RepID=M2RK87_TREDN) HSP 1 Score: 50.1 bits (118), Expect = 1.830e-5 Identity = 22/42 (52.38%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 3 GFSALHIAATRNDPDTIRVLLNMKVDVNSTNMSGATPLSCAI 44 G S LHIAA +NDP +R+L+NM D+ + N +GATPL+ A+ Sbjct: 66 GNSLLHIAAVKNDPIIVRLLINMDADIEAKNNTGATPLAAAL 107
BLAST of mRNA_L-elsbetiae_contig1310.2444.1 vs. uniprot
Match: Q73J83_TREDE (Ankyrin repeat protein n=10 Tax=Treponema denticola TaxID=158 RepID=Q73J83_TREDE) HSP 1 Score: 50.1 bits (118), Expect = 3.580e-5 Identity = 22/42 (52.38%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 3 GFSALHIAATRNDPDTIRVLLNMKVDVNSTNMSGATPLSCAI 44 G S LHIAA +NDP +R+L+NM D+ + N +GATPL+ A+ Sbjct: 66 GNSLLHIAAVKNDPIIVRLLINMDADIEAKNNTGATPLAAAL 107 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1310.2444.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1310.2444.1 ID=prot_L-elsbetiae_contig1310.2444.1|Name=mRNA_L-elsbetiae_contig1310.2444.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=80bpback to top |