prot_L-elsbetiae_contig12942.2333.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12942.2333.1 vs. uniprot
Match: D7FV03_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FV03_ECTSI) HSP 1 Score: 108 bits (271), Expect = 5.650e-30 Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0 Query: 1 RIRRLANEALVDIFRGLGGNGWRNKFGWLTPGTDVKQWHGVTVNSGSLVSLNLISNDLEV 60 +IRRLAN+ALVD+F LGG+ WRNK GWLTPGTDVK+WHGVTVN+GSLVSLNL+SNDLEV Sbjct: 12 QIRRLANQALVDVFNALGGDRWRNKSGWLTPGTDVKKWHGVTVNAGSLVSLNLMSNDLEV 71
BLAST of mRNA_L-elsbetiae_contig12942.2333.1 vs. uniprot
Match: D8LJ86_ECTSI (Leucine rich repeat protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LJ86_ECTSI) HSP 1 Score: 79.0 bits (193), Expect = 3.630e-16 Identity = 34/58 (58.62%), Postives = 47/58 (81.03%), Query Frame = 0 Query: 3 RRLANEALVDIFRGLGGNGWRNKFGWLTPGTDVKQWHGVTVN-SGSLVSLNLISNDLE 59 RR+AN+ L D++ LGG+ W+ + GWL PG+DV++WHG+T+ SG LVS+NLISNDLE Sbjct: 33 RRMANQGLQDLYDWLGGDNWKCRDGWLDPGSDVREWHGLTITTSGDLVSINLISNDLE 90
BLAST of mRNA_L-elsbetiae_contig12942.2333.1 vs. uniprot
Match: UPI00190B71DA (T6SS effector amidase Tae4 family protein n=1 Tax=Adhaeribacter terrigena TaxID=2793070 RepID=UPI00190B71DA) HSP 1 Score: 49.7 bits (117), Expect = 2.190e-5 Identity = 21/53 (39.62%), Postives = 32/53 (60.38%), Query Frame = 0 Query: 8 EALVDIFRGLGGNGWRNKFGWL--TPGTDVKQWHGVTVNSGSLVSLNLISNDL 58 ALV+++ G W N WL T TD WHG+TV++G ++ ++L SN+L Sbjct: 34 NALVELYNSTEGPNWNNNNNWLNGTSNTDFSSWHGLTVDNGDVIFIDLSSNNL 86
BLAST of mRNA_L-elsbetiae_contig12942.2333.1 vs. uniprot
Match: A0A401FQW3_9DELT (Uncharacterized protein n=2 Tax=Desulfonema ishimotonii TaxID=45657 RepID=A0A401FQW3_9DELT) HSP 1 Score: 48.9 bits (115), Expect = 4.070e-5 Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 0 Query: 8 EALVDIFRGLGGNGWRNKFGWLTPGTDVKQWHGVTVNSGSLVSLNLISNDL 58 EALV ++ G+ W NK GWLT WHGVTV G +V + L +N L Sbjct: 913 EALVALYNSTDGDNWTNKDGWLTDPV-AGNWHGVTVQGGHVVEIELKNNKL 962 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12942.2333.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12942.2333.1 ID=prot_L-elsbetiae_contig12942.2333.1|Name=mRNA_L-elsbetiae_contig12942.2333.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=60bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|