prot_L-elsbetiae_contig12475.2016.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12475.2016.1 vs. uniprot
Match: A0A6H5JEL9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEL9_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 6.130e-8 Identity = 27/34 (79.41%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 46 MLSDYDTLTLGGGGRPLTPVGQESQTTYQVPVAA 79 MLSD+DTLTLGG RP+TPVG+ESQT YQ+PVAA Sbjct: 1247 MLSDFDTLTLGGSERPVTPVGEESQTAYQIPVAA 1280
BLAST of mRNA_L-elsbetiae_contig12475.2016.1 vs. uniprot
Match: D8LLR2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLR2_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 9.670e-7 Identity = 25/32 (78.12%), Postives = 29/32 (90.62%), Query Frame = 0 Query: 46 MLSDYDTLTLGGGGRPLTPVGQESQTTYQVPV 77 MLSD+DTLTLGG RP+TPVG+ESQTTYQ+P Sbjct: 1115 MLSDFDTLTLGGSERPVTPVGEESQTTYQLPA 1146 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12475.2016.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12475.2016.1 ID=prot_L-elsbetiae_contig12475.2016.1|Name=mRNA_L-elsbetiae_contig12475.2016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=158bpback to top |