mRNA_L-elsbetiae_contig12475.2016.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12475.2016.1 vs. uniprot
Match: A0A6H5JEL9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEL9_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 7.890e-8 Identity = 27/34 (79.41%), Postives = 31/34 (91.18%), Query Frame = 1 Query: 163 MLSDYDTLTLGGGGRPLTPVGQESQTTYQVPVAA 264 MLSD+DTLTLGG RP+TPVG+ESQT YQ+PVAA Sbjct: 1247 MLSDFDTLTLGGSERPVTPVGEESQTAYQIPVAA 1280
BLAST of mRNA_L-elsbetiae_contig12475.2016.1 vs. uniprot
Match: D8LLR2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLR2_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 1.230e-6 Identity = 25/32 (78.12%), Postives = 29/32 (90.62%), Query Frame = 1 Query: 163 MLSDYDTLTLGGGGRPLTPVGQESQTTYQVPV 258 MLSD+DTLTLGG RP+TPVG+ESQTTYQ+P Sbjct: 1115 MLSDFDTLTLGGSERPVTPVGEESQTTYQLPA 1146 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12475.2016.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12475.2016.1 >prot_L-elsbetiae_contig12475.2016.1 ID=prot_L-elsbetiae_contig12475.2016.1|Name=mRNA_L-elsbetiae_contig12475.2016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=158bp MPPEKGRSAGGGGGSGGGGRRKDEAPAKRPSLNDGDDKGKGQGQVMLSDYback to top mRNA from alignment at L-elsbetiae_contig12475:3611..4111+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12475.2016.1 ID=mRNA_L-elsbetiae_contig12475.2016.1|Name=mRNA_L-elsbetiae_contig12475.2016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=501bp|location=Sequence derived from alignment at L-elsbetiae_contig12475:3611..4111+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12475:3611..4111+ >mRNA_L-elsbetiae_contig12475.2016.1 ID=mRNA_L-elsbetiae_contig12475.2016.1|Name=mRNA_L-elsbetiae_contig12475.2016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=948bp|location=Sequence derived from alignment at L-elsbetiae_contig12475:3611..4111+ (Laminarionema elsbetiae ELsaHSoW15)back to top |