prot_L-elsbetiae_contig1243.1982.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1243.1982.1 vs. uniprot
Match: D7FWS8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWS8_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 1.010e-13 Identity = 43/84 (51.19%), Postives = 55/84 (65.48%), Query Frame = 0 Query: 14 KFINADKRRRAARKKIALEANKRARAEKGRPKRAAKMATLVRLLDAAVQAEPWNVLLHDR--KKGEACGRTAGSRIPEGRRRHP 95 + I ADKRRRAARK LEA+++ARAE RP+R KMA L+RLLDA ++ EPWN+ H + + E CGR + EG R P Sbjct: 16 RVIEADKRRRAARKAKGLEASRKARAEMRRPRRDEKMALLLRLLDAVLEVEPWNLARHTKVSEAWEECGRRVPGYLKEGARTEP 99 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1243.1982.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1243.1982.1 ID=prot_L-elsbetiae_contig1243.1982.1|Name=mRNA_L-elsbetiae_contig1243.1982.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=106bpback to top |