prot_L-elsbetiae_contig12368.1941.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Match: D7FSU7_ECTSI (FYVE-type domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FSU7_ECTSI) HSP 1 Score: 84.0 bits (206), Expect = 1.280e-17 Identity = 35/45 (77.78%), Postives = 42/45 (93.33%), Query Frame = 0 Query: 7 KAQSVKGVMGASTVDSSLWVPDDMALNCCVCKAEFTMYRRRHHCR 51 K+QSV+G MG+S+VD+S+WVPDDMA NCCVCKAEF +YRRRHHCR Sbjct: 67 KSQSVRGPMGSSSVDASMWVPDDMAPNCCVCKAEFAVYRRRHHCR 111
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Match: A0A7S0SXA2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0SXA2_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 6.240e-6 Identity = 16/28 (57.14%), Postives = 23/28 (82.14%), Query Frame = 0 Query: 24 LWVPDDMALNCCVCKAEFTMYRRRHHCR 51 +WVPD + CC+CK++F ++RRRHHCR Sbjct: 69 IWVPDTIEDKCCICKSDFNIWRRRHHCR 96
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Match: A0A152A990_9MYCE (Pleckstrin (PH) domain-containing protein n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A152A990_9MYCE) HSP 1 Score: 49.7 bits (117), Expect = 1.520e-5 Identity = 17/32 (53.12%), Postives = 26/32 (81.25%), Query Frame = 0 Query: 20 VDSSLWVPDDMALNCCVCKAEFTMYRRRHHCR 51 +D S W+PD++++NC +CK EF++ RRHHCR Sbjct: 9 IDRSNWIPDELSINCMLCKKEFSVLFRRHHCR 40
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Match: A0A1J4KME0_9EUKA (FYVE zinc finger family protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4KME0_9EUKA) HSP 1 Score: 49.3 bits (116), Expect = 2.080e-5 Identity = 17/28 (60.71%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 24 LWVPDDMALNCCVCKAEFTMYRRRHHCR 51 +W+PDD+A NC VCK++FT+ R+HHCR Sbjct: 331 VWIPDDLAPNCMVCKSKFTVINRKHHCR 358
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Match: A0A137P479_CONC2 (Uncharacterized protein n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137P479_CONC2) HSP 1 Score: 48.9 bits (115), Expect = 2.880e-5 Identity = 21/47 (44.68%), Postives = 29/47 (61.70%), Query Frame = 0 Query: 7 KAQSVKGVMGASTVDSS--LWVPDDMALNCCVCKAEFTMYRRRHHCR 51 K Q V+ + D S +W+PD A NC +C EFT++RR+HHCR Sbjct: 746 KKQLVEAALNRVVTDYSAPVWIPDANADNCMICSEEFTLFRRKHHCR 792
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Match: A0A507CXB0_9FUNG (Uncharacterized protein n=1 Tax=Synchytrium endobioticum TaxID=286115 RepID=A0A507CXB0_9FUNG) HSP 1 Score: 47.8 bits (112), Expect = 7.340e-5 Identity = 16/28 (57.14%), Postives = 23/28 (82.14%), Query Frame = 0 Query: 24 LWVPDDMALNCCVCKAEFTMYRRRHHCR 51 +W+PDD A +C CK EF+++RR+HHCR Sbjct: 435 IWIPDDQASSCMQCKEEFSIFRRKHHCR 462 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12368.1941.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12368.1941.1 ID=prot_L-elsbetiae_contig12368.1941.1|Name=mRNA_L-elsbetiae_contig12368.1941.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bpback to top |