prot_L-elsbetiae_contig12321.1918.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12321.1918.1 vs. uniprot
Match: D7FSD6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSD6_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 4.460e-11 Identity = 33/50 (66.00%), Postives = 40/50 (80.00%), Query Frame = 0 Query: 5 EAAEAAAARTGASNGRTSGWDLSGKDDTGIRPQQRKTRLSYLLAAEGDND 54 EAA AAAA TGAS+GR SGWDLSG DTG+RPQ++ TRLSYL+ ++ D Sbjct: 110 EAAAAAAALTGASSGRKSGWDLSGGGDTGVRPQEKHTRLSYLVGSDSSGD 159
BLAST of mRNA_L-elsbetiae_contig12321.1918.1 vs. uniprot
Match: A0A6H5JS13_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JS13_9PHAE) HSP 1 Score: 64.3 bits (155), Expect = 2.980e-10 Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 12 ARTGASNGRTSGWDLSGKDDTGIRPQQRKTRLSYLLAAEGDNDDATSGGGG 62 A TGAS+GR SGWDLSG+ DTG+RPQ + TRLSYL+ E DD SG GG Sbjct: 132 ALTGASSGRKSGWDLSGEGDTGVRPQAKHTRLSYLVEPESGGDDRESGRGG 182 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12321.1918.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12321.1918.1 ID=prot_L-elsbetiae_contig12321.1918.1|Name=mRNA_L-elsbetiae_contig12321.1918.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bpback to top |