mRNA_L-elsbetiae_contig12321.1918.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12321.1918.1 vs. uniprot
Match: D7FSD6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSD6_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 5.010e-11 Identity = 33/50 (66.00%), Postives = 40/50 (80.00%), Query Frame = 2 Query: 23 EAAEAAAARTGASNGRTSGWDLSGKDDTGIRPQQRKTRLSYLLAAEGDND 172 EAA AAAA TGAS+GR SGWDLSG DTG+RPQ++ TRLSYL+ ++ D Sbjct: 110 EAAAAAAALTGASSGRKSGWDLSGGGDTGVRPQEKHTRLSYLVGSDSSGD 159
BLAST of mRNA_L-elsbetiae_contig12321.1918.1 vs. uniprot
Match: A0A6H5JS13_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JS13_9PHAE) HSP 1 Score: 64.3 bits (155), Expect = 3.350e-10 Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 44 ARTGASNGRTSGWDLSGKDDTGIRPQQRKTRLSYLLAAEGDNDDATSGGGG 196 A TGAS+GR SGWDLSG+ DTG+RPQ + TRLSYL+ E DD SG GG Sbjct: 132 ALTGASSGRKSGWDLSGEGDTGVRPQAKHTRLSYLVEPESGGDDRESGRGG 182 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12321.1918.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12321.1918.1 >prot_L-elsbetiae_contig12321.1918.1 ID=prot_L-elsbetiae_contig12321.1918.1|Name=mRNA_L-elsbetiae_contig12321.1918.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bp MKAAEAAEAAAARTGASNGRTSGWDLSGKDDTGIRPQQRKTRLSYLLAAEback to top mRNA from alignment at L-elsbetiae_contig12321:3292..3535+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12321.1918.1 ID=mRNA_L-elsbetiae_contig12321.1918.1|Name=mRNA_L-elsbetiae_contig12321.1918.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=244bp|location=Sequence derived from alignment at L-elsbetiae_contig12321:3292..3535+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12321:3292..3535+ >mRNA_L-elsbetiae_contig12321.1918.1 ID=mRNA_L-elsbetiae_contig12321.1918.1|Name=mRNA_L-elsbetiae_contig12321.1918.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=468bp|location=Sequence derived from alignment at L-elsbetiae_contig12321:3292..3535+ (Laminarionema elsbetiae ELsaHSoW15)back to top |