prot_L-elsbetiae_contig12284.1889.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12284.1889.1 vs. uniprot
Match: A0A7S0KUS0_MICPS (Hypothetical protein (Fragment) n=2 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0KUS0_MICPS) HSP 1 Score: 56.2 bits (134), Expect = 1.830e-7 Identity = 31/67 (46.27%), Postives = 38/67 (56.72%), Query Frame = 0 Query: 28 DDDEVYQYPRAGLGPVFASIEGLLRCAICGGLSDPPVSLPCCQQTFCSLCIRQSLDSTKPRCPCCRV 94 DDDE +PR ++ LRCAICG L PVS C T+CSLCIR++L+ K CP CR Sbjct: 24 DDDEPESWPRVEQ----RRLDESLRCAICGDLFGMPVSFATCTHTYCSLCIRRTLEFKK-ECPTCRT 85
BLAST of mRNA_L-elsbetiae_contig12284.1889.1 vs. uniprot
Match: C1ECC7_MICCC (RING-type E3 ubiquitin transferase n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1ECC7_MICCC) HSP 1 Score: 55.8 bits (133), Expect = 5.550e-7 Identity = 31/67 (46.27%), Postives = 38/67 (56.72%), Query Frame = 0 Query: 28 DDDEVYQYPRAGLGPVFASIEGLLRCAICGGLSDPPVSLPCCQQTFCSLCIRQSLDSTKPRCPCCRV 94 DDDE +PR ++ LRCAICG L PVS C T+CSLCIR++L+ K CP CR Sbjct: 6 DDDEPEAWPRVEQ----RRLDESLRCAICGDLFGMPVSFATCTHTYCSLCIRRTLEFKK-ECPTCRT 67
BLAST of mRNA_L-elsbetiae_contig12284.1889.1 vs. uniprot
Match: A0A835WUB3_9CHLO (RING-type domain-containing protein n=1 Tax=Chlamydomonas schloesseri TaxID=2026947 RepID=A0A835WUB3_9CHLO) HSP 1 Score: 53.5 bits (127), Expect = 3.780e-6 Identity = 30/59 (50.85%), Postives = 32/59 (54.24%), Query Frame = 0 Query: 42 PVFASIEGLLRCAICGGLSDPPVSLPCCQQTFCSLCIRQSLD-----STKPRCPCCRVD 95 P + L C IC GL D PVS PC TFCS+CIRQSLD K CP CR D Sbjct: 8 PELGDLAEALTCPICKGLFDGPVSPPC-GHTFCSMCIRQSLDFAHANKQKGTCPSCRAD 65
BLAST of mRNA_L-elsbetiae_contig12284.1889.1 vs. uniprot
Match: A0A8H5HNE0_9AGAR (Postreplication repair E3 ubiquitin-protein ligase RAD18 n=1 Tax=Tricholomella constricta TaxID=117010 RepID=A0A8H5HNE0_9AGAR) HSP 1 Score: 52.8 bits (125), Expect = 6.630e-6 Identity = 27/59 (45.76%), Postives = 35/59 (59.32%), Query Frame = 0 Query: 35 YPRAGLGPVFASIEGLLRCAICGGLSDPPVSLPCCQQTFCSLCIRQSLDSTKPRCPCCR 93 +P + P +++G LRC ICG L D PV+L C FCS C+R SL + K CP CR Sbjct: 15 FPPLTIAPGLRTLDGSLRCNICGELFDAPVTLNC-GHCFCSFCVRSSL-AEKQECPACR 71
BLAST of mRNA_L-elsbetiae_contig12284.1889.1 vs. uniprot
Match: A0A7S3C9W6_9CHLO (Hypothetical protein n=1 Tax=Chloropicon roscoffensis TaxID=1461544 RepID=A0A7S3C9W6_9CHLO) HSP 1 Score: 51.6 bits (122), Expect = 1.690e-5 Identity = 27/54 (50.00%), Postives = 33/54 (61.11%), Query Frame = 0 Query: 46 SIEGLLRCAICGGLSDPPVSLPCCQQTFCSLCIRQSLD----STKPRCPCCRVD 95 ++E LRC IC D PVS+ C +FCSLCIR SL+ + PRCP CR D Sbjct: 38 TLEESLRCDICKEFLDAPVSVAGCGHSFCSLCIRASLEFQQRAGSPRCPTCRGD 91 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12284.1889.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12284.1889.1 ID=prot_L-elsbetiae_contig12284.1889.1|Name=mRNA_L-elsbetiae_contig12284.1889.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=95bpback to top |