prot_L-elsbetiae_contig12223.1848.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12223.1848.1 vs. uniprot
Match: A0A6H5K5B5_9PHAE (BAH domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5K5B5_9PHAE) HSP 1 Score: 102 bits (255), Expect = 1.780e-23 Identity = 51/83 (61.45%), Postives = 61/83 (73.49%), Query Frame = 0 Query: 4 PGPEAETSCVSQVFMLSVKLTLIPELFDKFVMALTDYRRQRILIHELVDVVSECFDHREVREMRLVEEFNTFLPPGHAVHALR 86 P P+AET V VFM K TL PE FDKFV AL+ YR QR+ I ELVDVV +CF+H E RE++LV+EFN+FLPPG+AV R Sbjct: 1199 PRPQAETGSVLHVFMDRCKATLTPERFDKFVSALSQYREQRLSIGELVDVVGQCFNHHEEREVKLVKEFNSFLPPGNAVKITR 1281 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12223.1848.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12223.1848.1 ID=prot_L-elsbetiae_contig12223.1848.1|Name=mRNA_L-elsbetiae_contig12223.1848.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=94bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|