prot_L-elsbetiae_contig12207.1840.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12207.1840.1 vs. uniprot
Match: D8LMT7_ECTSI (Phasmid Socket Absent family member (Psa-1) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMT7_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 1.720e-13 Identity = 37/44 (84.09%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 12 RVQRLEAKLHCFDELDQVLETERQSVEHARAELLLEQARSMLSK 55 RVQRLEAKLHCFDELDQVLETER +EH RAEL+ EQARSML K Sbjct: 164 RVQRLEAKLHCFDELDQVLETERACLEHDRAELVFEQARSMLPK 207
BLAST of mRNA_L-elsbetiae_contig12207.1840.1 vs. uniprot
Match: A0A6H5JSE9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSE9_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.420e-13 Identity = 37/44 (84.09%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 12 RVQRLEAKLHCFDELDQVLETERQSVEHARAELLLEQARSMLSK 55 RVQRLEAKLHCFDELDQVLETER +EH RAEL+ EQARSML K Sbjct: 1081 RVQRLEAKLHCFDELDQVLETERACLEHDRAELVFEQARSMLPK 1124 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12207.1840.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12207.1840.1 ID=prot_L-elsbetiae_contig12207.1840.1|Name=mRNA_L-elsbetiae_contig12207.1840.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=56bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|