prot_L-elsbetiae_contig12186.1818.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12186.1818.1 vs. uniprot
Match: D7G0P2_ECTSI (Origin recognition complex subunit 4 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0P2_ECTSI) HSP 1 Score: 79.0 bits (193), Expect = 5.330e-16 Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 0 Query: 1 MMVESMKTGKVDGVPVIFVLDVFERFTCRKPQTLLYALLDLCQ 43 MMV+SMKTG V+GVPV+FVLD FERF CRKPQTLLYALLDLCQ Sbjct: 164 MMVDSMKTGAVNGVPVVFVLDEFERFACRKPQTLLYALLDLCQ 206
BLAST of mRNA_L-elsbetiae_contig12186.1818.1 vs. uniprot
Match: A0A6H5JJU9_9PHAE (Origin recognition complex subunit 4 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJU9_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 5.380e-16 Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 0 Query: 1 MMVESMKTGKVDGVPVIFVLDVFERFTCRKPQTLLYALLDLCQ 43 MMV+SMKTG V+GVPVIF+LD FERF CRKPQTLLYALLDLCQ Sbjct: 202 MMVDSMKTGAVNGVPVIFILDEFERFACRKPQTLLYALLDLCQ 244 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12186.1818.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12186.1818.1 ID=prot_L-elsbetiae_contig12186.1818.1|Name=mRNA_L-elsbetiae_contig12186.1818.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=45bpback to top |