prot_L-elsbetiae_contig1217.1803.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1217.1803.1 vs. uniprot
Match: A0A6H5LDY4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LDY4_9PHAE) HSP 1 Score: 97.4 bits (241), Expect = 2.120e-21 Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = 0 Query: 30 VLSIHFFGRAITLDLWFASETEAVEWQGMLMKLSWKEQGYMYRGPPGDAGGG 81 V+SIHFFGR ITLDLWFASETEAVEWQG+L KLSWKEQGY+Y P GD+GGG Sbjct: 851 VMSIHFFGRTITLDLWFASETEAVEWQGLLTKLSWKEQGYLYGAPSGDSGGG 902
BLAST of mRNA_L-elsbetiae_contig1217.1803.1 vs. uniprot
Match: D7FIV6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIV6_ECTSI) HSP 1 Score: 95.9 bits (237), Expect = 7.240e-21 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0 Query: 30 VLSIHFFGRAITLDLWFASETEAVEWQGMLMKLSWKEQGYMYRGPPGDAGG 80 V+SIHFFGR ITLDLWFASETEAVEWQGML KLSWKEQGY+Y P GD+GG Sbjct: 623 VMSIHFFGRTITLDLWFASETEAVEWQGMLTKLSWKEQGYLYGPPSGDSGG 673 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1217.1803.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1217.1803.1 ID=prot_L-elsbetiae_contig1217.1803.1|Name=mRNA_L-elsbetiae_contig1217.1803.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=105bpback to top |