prot_L-elsbetiae_contig11979.1683.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: D8LKW1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LKW1_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 1.970e-10 Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 5 QKEAAIRDDYLQSRSTGEK------HIGTGGMADTRDPAPVNHADPRK 46 QK+A++ DDY+ ++S+G H GTGGMADTRDPAPVNHADPRK Sbjct: 314 QKQASMFDDYMSTQSSGSSSKTAPGHKGTGGMADTRDPAPVNHADPRK 361
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: A0A835YTB4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTB4_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 4.470e-6 Identity = 21/29 (72.41%), Postives = 23/29 (79.31%), Query Frame = 0 Query: 18 RSTGEKHIGTGGMADTRDPAPVNHADPRK 46 R+ EKH G GGMADTRDP PV+H DPRK Sbjct: 31 RAEDEKHRGVGGMADTRDPEPVDHEDPRK 59
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: A0A835YLE0_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YLE0_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 8.980e-6 Identity = 21/28 (75.00%), Postives = 22/28 (78.57%), Query Frame = 0 Query: 19 STGEKHIGTGGMADTRDPAPVNHADPRK 46 S EKH G GGMADTRDP PV+H DPRK Sbjct: 30 SAEEKHRGVGGMADTRDPEPVDHEDPRK 57
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: D7G2R1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G2R1_ECTSI) HSP 1 Score: 48.9 bits (115), Expect = 1.580e-5 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 0 Query: 21 GEKHIGTGGMADTRDPAPVNHADPRK 46 GEKHIGTGGMADTRDP ++H DPRK Sbjct: 167 GEKHIGTGGMADTRDPDALDHEDPRK 192
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: A0A6H5JPP9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPP9_9PHAE) HSP 1 Score: 47.4 bits (111), Expect = 7.660e-5 Identity = 25/42 (59.52%), Postives = 28/42 (66.67%), Query Frame = 0 Query: 5 QKEAAIRDDYLQSRSTGEKHIGTGGMADTRDPAPVNHADPRK 46 QKE++ S+ T H GTGGMADTRDPAPV H DPRK Sbjct: 300 QKESSPTPTTTSSK-TPPGHKGTGGMADTRDPAPVKHEDPRK 340
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: D7G2R0_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G2R0_ECTSI) HSP 1 Score: 47.4 bits (111), Expect = 7.680e-5 Identity = 20/29 (68.97%), Postives = 24/29 (82.76%), Query Frame = 0 Query: 18 RSTGEKHIGTGGMADTRDPAPVNHADPRK 46 ++ EKHIGTGGMADTRDP ++H DPRK Sbjct: 369 KAADEKHIGTGGMADTRDPDALDHEDPRK 397 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig11979.1683.1 ID=prot_L-elsbetiae_contig11979.1683.1|Name=mRNA_L-elsbetiae_contig11979.1683.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=46bpback to top |