mRNA_L-elsbetiae_contig11979.1683.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: D8LKW1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LKW1_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 5.230e-10 Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 3 Query: 39 QKEAAIRDDYLQSRSTGEK------HIGTGGMADTRDPAPVNHADPRK 164 QK+A++ DDY+ ++S+G H GTGGMADTRDPAPVNHADPRK Sbjct: 314 QKQASMFDDYMSTQSSGSSSKTAPGHKGTGGMADTRDPAPVNHADPRK 361
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: A0A835YTB4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTB4_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 6.220e-6 Identity = 21/29 (72.41%), Postives = 23/29 (79.31%), Query Frame = 3 Query: 78 RSTGEKHIGTGGMADTRDPAPVNHADPRK 164 R+ EKH G GGMADTRDP PV+H DPRK Sbjct: 31 RAEDEKHRGVGGMADTRDPEPVDHEDPRK 59
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: A0A835YLE0_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YLE0_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 1.250e-5 Identity = 21/28 (75.00%), Postives = 22/28 (78.57%), Query Frame = 3 Query: 81 STGEKHIGTGGMADTRDPAPVNHADPRK 164 S EKH G GGMADTRDP PV+H DPRK Sbjct: 30 SAEEKHRGVGGMADTRDPEPVDHEDPRK 57
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Match: D7G2R1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G2R1_ECTSI) HSP 1 Score: 48.9 bits (115), Expect = 2.210e-5 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 3 Query: 87 GEKHIGTGGMADTRDPAPVNHADPRK 164 GEKHIGTGGMADTRDP ++H DPRK Sbjct: 167 GEKHIGTGGMADTRDPDALDHEDPRK 192 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11979.1683.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11979.1683.1 >prot_L-elsbetiae_contig11979.1683.1 ID=prot_L-elsbetiae_contig11979.1683.1|Name=mRNA_L-elsbetiae_contig11979.1683.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=46bp MPPAQKEAAIRDDYLQSRSTGEKHIGTGGMADTRDPAPVNHADPRKback to top mRNA from alignment at L-elsbetiae_contig11979:1557..3200+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11979.1683.1 ID=mRNA_L-elsbetiae_contig11979.1683.1|Name=mRNA_L-elsbetiae_contig11979.1683.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1644bp|location=Sequence derived from alignment at L-elsbetiae_contig11979:1557..3200+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11979:1557..3200+ >mRNA_L-elsbetiae_contig11979.1683.1 ID=mRNA_L-elsbetiae_contig11979.1683.1|Name=mRNA_L-elsbetiae_contig11979.1683.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=276bp|location=Sequence derived from alignment at L-elsbetiae_contig11979:1557..3200+ (Laminarionema elsbetiae ELsaHSoW15)back to top |