prot_L-elsbetiae_contig11858.1594.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11858.1594.1 vs. uniprot
Match: D8LD92_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LD92_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 8.720e-14 Identity = 31/36 (86.11%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 1 VRFSHQIRVILVASRLEMSSVKADVWWGEKDYCDFR 36 VRFS+QIRVILVASRLE+SSVK D+WWGE+DYCDFR Sbjct: 5 VRFSNQIRVILVASRLELSSVKTDIWWGERDYCDFR 40
BLAST of mRNA_L-elsbetiae_contig11858.1594.1 vs. uniprot
Match: A0A6H5L2K1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2K1_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 3.600e-13 Identity = 29/36 (80.56%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 1 VRFSHQIRVILVASRLEMSSVKADVWWGEKDYCDFR 36 VRFS+QIRV+LVASRLE+SS+K D+WWGE+DYCDFR Sbjct: 257 VRFSNQIRVVLVASRLELSSMKTDIWWGERDYCDFR 292 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11858.1594.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig11858.1594.1 ID=prot_L-elsbetiae_contig11858.1594.1|Name=mRNA_L-elsbetiae_contig11858.1594.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=37bpback to top |