prot_L-elsbetiae_contig1178.1535.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1178.1535.1 vs. uniprot
Match: D8LG92_ECTSI (F5/8 type C domain protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LG92_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 1.010e-12 Identity = 26/40 (65.00%), Postives = 36/40 (90.00%), Query Frame = 0 Query: 6 QGSPEPVQLAPTECNNKRGVAFGFQDAGDIDTLKDGLSWW 45 +GS EPV+L PT+C++KRGVAFGF+++GD+ TLK G+SWW Sbjct: 85 EGSSEPVELVPTQCSSKRGVAFGFKESGDLYTLKTGISWW 124
BLAST of mRNA_L-elsbetiae_contig1178.1535.1 vs. uniprot
Match: A0A6H5KQ88_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ88_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 4.290e-11 Identity = 24/40 (60.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 6 QGSPEPVQLAPTECNNKRGVAFGFQDAGDIDTLKDGLSWW 45 +G EPV+L PT+C++KRGVAFGF+++ D+ TLK G+SWW Sbjct: 48 EGHSEPVELVPTQCSSKRGVAFGFKESDDLYTLKKGISWW 87 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1178.1535.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1178.1535.1 ID=prot_L-elsbetiae_contig1178.1535.1|Name=mRNA_L-elsbetiae_contig1178.1535.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=46bpback to top |