prot_L-elsbetiae_contig1156.1359.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: D8LJN8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJN8_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 2.510e-11 Identity = 24/39 (61.54%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTETAG 41 C+PNPCLN G+C +DP GG+ C+CS YGGM C+T+T G Sbjct: 383 CNPNPCLNEGSCEVDPNGGYSCSCSSSYGGMNCETDTTG 421
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: D7G7J6_ECTSI (Putative zinc metalloendopeptidase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7J6_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 4.670e-11 Identity = 22/39 (56.41%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTETAG 41 C+PNPC+NGG+C +DP GG+ C+C YGGM C+T+ G Sbjct: 505 CNPNPCMNGGSCEVDPNGGYTCSCGSSYGGMMCETDVTG 543
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: D8LED1_ECTSI (PR1-like metalloprotease n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LED1_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 4.670e-11 Identity = 22/39 (56.41%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTETAG 41 C+PNPC+NGG+C +DP GG+ C+C YGGM C+T+ G Sbjct: 414 CNPNPCMNGGSCEVDPNGGYTCSCGSSYGGMMCETDVTG 452
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: D8LED3_ECTSI (WSC domain protein n=3 Tax=Ectocarpus TaxID=2879 RepID=D8LED3_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 4.670e-11 Identity = 22/39 (56.41%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTETAG 41 C+PNPC+NGG+C +DP GG+ C+C YGGM C+T+ G Sbjct: 401 CNPNPCMNGGSCEVDPNGGYTCSCGSSYGGMMCETDVTG 439
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: D8LED2_ECTSI (Ig-like protein, group 2 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LED2_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 6.360e-11 Identity = 22/39 (56.41%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTETAG 41 CDPNPC+NGG+C +DP GG+ C+C YG M C+T+ G Sbjct: 127 CDPNPCMNGGSCEVDPNGGYTCSCGSSYGAMMCETDVTG 165
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: UPI001BD2818B (hyaluronan-binding protein 2-like n=1 Tax=Cheilinus undulatus TaxID=241271 RepID=UPI001BD2818B) HSP 1 Score: 54.7 bits (130), Expect = 1.590e-7 Identity = 22/37 (59.46%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 1 DTCDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQT 37 D CDPNPCLNGG+C GGG +C C + Y G +CQT Sbjct: 65 DQCDPNPCLNGGSCDTYVGGGFICACPEPYTGKKCQT 101
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: A0A820F2F2_9BILA (Hypothetical protein (Fragment) n=1 Tax=Rotaria sordida TaxID=392033 RepID=A0A820F2F2_9BILA) HSP 1 Score: 52.4 bits (124), Expect = 3.450e-7 Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 1 DTCDPNPCLNGGTCAIDPG-GGHLCTCSDGYGGMQCQT 37 D C PNPCLNGGTC G GG+ CTC G+ G++C+T Sbjct: 4 DACQPNPCLNGGTCRPTNGNGGYQCTCPSGFTGLRCET 41
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: A0A815TX07_9BILA (Hypothetical protein (Fragment) n=1 Tax=Rotaria sordida TaxID=392033 RepID=A0A815TX07_9BILA) HSP 1 Score: 51.2 bits (121), Expect = 5.270e-7 Identity = 19/36 (52.78%), Postives = 25/36 (69.44%), Query Frame = 0 Query: 1 DTCDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQ 36 D C+PNPCLNGGTC + GG +C C G+ G +C+ Sbjct: 1 DVCNPNPCLNGGTCMTNGVGGFICQCPPGFSGQRCE 36
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: A0A821E1S3_9BILA (Hypothetical protein (Fragment) n=1 Tax=Rotaria magnacalcarata TaxID=392030 RepID=A0A821E1S3_9BILA) HSP 1 Score: 50.1 bits (118), Expect = 5.990e-7 Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTET 39 C PNPC NGG+CA+ PGGG C C G+ G +C+ + Sbjct: 12 CLPNPCRNGGSCAVVPGGGFRCICGAGFTGARCELSS 48
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Match: A0A8B8B0W9_CRAVI (protocadherin Fat 4-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=A0A8B8B0W9_CRAVI) HSP 1 Score: 51.6 bits (122), Expect = 1.260e-6 Identity = 20/39 (51.28%), Postives = 26/39 (66.67%), Query Frame = 0 Query: 3 CDPNPCLNGGTCAIDPGGGHLCTCSDGYGGMQCQTETAG 41 C+PNPCLNGGTC+ G +C C G+ G CQT+ +G Sbjct: 24 CNPNPCLNGGTCSQSSSGSAVCACVQGWTGSLCQTQVSG 62 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1156.1359.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1156.1359.1 ID=prot_L-elsbetiae_contig1156.1359.1|Name=mRNA_L-elsbetiae_contig1156.1359.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=41bpback to top |