prot_L-elsbetiae_contig11528.1339.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11528.1339.1 vs. uniprot
Match: A0A6H5KJL2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJL2_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 6.120e-11 Identity = 34/43 (79.07%), Postives = 38/43 (88.37%), Query Frame = 0 Query: 5 SQDGLREKVVAMGGSFDVNLTTSTTHLVAASSETEKYRVATRM 47 +Q+ LREKV AMGGSFDVNLT STTHL+AAS +TEKYRVAT M Sbjct: 23 TQEDLREKVNAMGGSFDVNLTMSTTHLLAASLDTEKYRVATGM 65
BLAST of mRNA_L-elsbetiae_contig11528.1339.1 vs. uniprot
Match: D7G795_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G795_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 6.120e-11 Identity = 35/45 (77.78%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 3 AVSQDGLREKVVAMGGSFDVNLTTSTTHLVAASSETEKYRVATRM 47 A Q+ LREKV AMGGSFDVNLT STTHL+AAS +TEKYRVAT M Sbjct: 18 AHQQEDLREKVNAMGGSFDVNLTMSTTHLLAASLDTEKYRVATGM 62 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11528.1339.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig11528.1339.1 ID=prot_L-elsbetiae_contig11528.1339.1|Name=mRNA_L-elsbetiae_contig11528.1339.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=47bpback to top |