mRNA_L-elsbetiae_contig11528.1339.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11528.1339.1 vs. uniprot
Match: A0A6H5KJL2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJL2_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 6.120e-11 Identity = 34/43 (79.07%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 13 SQDGLREKVVAMGGSFDVNLTTSTTHLVAASSETEKYRVATRM 141 +Q+ LREKV AMGGSFDVNLT STTHL+AAS +TEKYRVAT M Sbjct: 23 TQEDLREKVNAMGGSFDVNLTMSTTHLLAASLDTEKYRVATGM 65
BLAST of mRNA_L-elsbetiae_contig11528.1339.1 vs. uniprot
Match: D7G795_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G795_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 6.120e-11 Identity = 35/45 (77.78%), Postives = 38/45 (84.44%), Query Frame = 1 Query: 7 AVSQDGLREKVVAMGGSFDVNLTTSTTHLVAASSETEKYRVATRM 141 A Q+ LREKV AMGGSFDVNLT STTHL+AAS +TEKYRVAT M Sbjct: 18 AHQQEDLREKVNAMGGSFDVNLTMSTTHLLAASLDTEKYRVATGM 62 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11528.1339.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11528.1339.1 >prot_L-elsbetiae_contig11528.1339.1 ID=prot_L-elsbetiae_contig11528.1339.1|Name=mRNA_L-elsbetiae_contig11528.1339.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=47bp WTAVSQDGLREKVVAMGGSFDVNLTTSTTHLVAASSETEKYRVATRMback to top mRNA from alignment at L-elsbetiae_contig11528:5060..5200+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11528.1339.1 ID=mRNA_L-elsbetiae_contig11528.1339.1|Name=mRNA_L-elsbetiae_contig11528.1339.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=141bp|location=Sequence derived from alignment at L-elsbetiae_contig11528:5060..5200+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11528:5060..5200+ >mRNA_L-elsbetiae_contig11528.1339.1 ID=mRNA_L-elsbetiae_contig11528.1339.1|Name=mRNA_L-elsbetiae_contig11528.1339.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=282bp|location=Sequence derived from alignment at L-elsbetiae_contig11528:5060..5200+ (Laminarionema elsbetiae ELsaHSoW15)back to top |