prot_L-elsbetiae_contig10968.870.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig10968.870.1 vs. uniprot
Match: A0A086TF94_ACRC1 (Galactose oxidase-like protein n=1 Tax=Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / IAM 14645 / JCM 23072 / IMI 49137) TaxID=857340 RepID=A0A086TF94_ACRC1) HSP 1 Score: 52.8 bits (125), Expect = 2.660e-6 Identity = 25/69 (36.23%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 1 PQACLKTCIADAAFKTSYFALAEGSACYCGNPQPVDE------ERGICEEPCAGDVSSMCGGVKSFDLY 63 P C C A F A+ G+ CYCG+P +D + G+C+ PCAG+ ++MCGG S Y Sbjct: 52 PMVCTNAC---AEFGYMAAAMGHGNICYCGDPANIDTAGAKFVDEGLCDIPCAGNGTAMCGGGSSLSTY 117
BLAST of mRNA_L-elsbetiae_contig10968.870.1 vs. uniprot
Match: A0A6H5KL41_9PHAE (WSC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL41_9PHAE) HSP 1 Score: 50.4 bits (119), Expect = 1.240e-5 Identity = 21/52 (40.38%), Postives = 29/52 (55.77%), Query Frame = 0 Query: 19 FALAEGSACYCGNPQPV----DEERGICEEPCAGDVSSMCGGVKSFDLYEIA 66 FA+ G C C D + G+C+ PC GD S CGGV SFD+Y+++ Sbjct: 138 FAVTRGDLCTCFTEADTGIFDDRKGGVCDAPCTGDSSQPCGGVDSFDVYQLS 189
BLAST of mRNA_L-elsbetiae_contig10968.870.1 vs. uniprot
Match: A0A8K0TT44_9PEZI (WSC domain-containing protein n=1 Tax=Plectosphaerella cucumerina TaxID=40658 RepID=A0A8K0TT44_9PEZI) HSP 1 Score: 49.7 bits (117), Expect = 3.210e-5 Identity = 29/68 (42.65%), Postives = 34/68 (50.00%), Query Frame = 0 Query: 5 LKTCIA---DAAFKTSYFALAEGSACYCGNP-----QPVDEERGICEEPCAGDVSSMCGGVKSFDLYE 64 ++TCIA D +K Y L CYCGN PV G+CE PC GD S +CGG LYE Sbjct: 386 VETCIAFCNDRGYK--YAGLEYQRECYCGNDVAADRAPVKGILGVCEMPCKGDNSQICGGYGGLSLYE 451 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig10968.870.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig10968.870.1 ID=prot_L-elsbetiae_contig10968.870.1|Name=mRNA_L-elsbetiae_contig10968.870.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=70bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|