prot_L-elsbetiae_contig10346.379.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig10346.379.1 vs. uniprot
Match: D8LJI6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJI6_ECTSI) HSP 1 Score: 80.9 bits (198), Expect = 8.650e-15 Identity = 34/43 (79.07%), Postives = 39/43 (90.70%), Query Frame = 0 Query: 105 SMEKGCREDGCNRRPIYAYKGSTRAAFCARHRLAGMIDTRHPL 147 S +GC+EDGC+RRPIYAYKGS +AA+CARHRL GMIDTRHPL Sbjct: 461 SSGRGCKEDGCDRRPIYAYKGSKKAAYCARHRLTGMIDTRHPL 503
BLAST of mRNA_L-elsbetiae_contig10346.379.1 vs. uniprot
Match: D8LBU9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBU9_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 3.290e-13 Identity = 35/66 (53.03%), Postives = 44/66 (66.67%), Query Frame = 0 Query: 94 RERSDPVPPGGSMEKGCREDGCNRRPIYAYKGSTRAAFCARHRLAGMIDTRHPLCKDEQCTRQPSF 159 +E V P G+ CR+ GC+RRPIYA+KG T+A C HR A M++ RHPLC+ E C RQPSF Sbjct: 444 KETGTTVAPKGAQA--CRDVGCHRRPIYAFKGDTKALCCPIHRSAEMVNVRHPLCRHESCFRQPSF 507
BLAST of mRNA_L-elsbetiae_contig10346.379.1 vs. uniprot
Match: A0A6H5K8Z0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8Z0_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 4.050e-8 Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 93 RRERSDPVPPGGSMEKGCREDGCNRRPIYAYKGSTRAAFCARHR 136 RR + P S +GC+EDGC+RRPIYAYKGS +AA+CARHR Sbjct: 531 RRAANAATPSAPSSGRGCKEDGCDRRPIYAYKGSKKAAYCARHR 574
BLAST of mRNA_L-elsbetiae_contig10346.379.1 vs. uniprot
Match: A0A6H5KXM5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXM5_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 1.710e-6 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 94 RERSDPVPPGGSMEKGCREDGCNRRPIYAYKGSTRAAFCARHRLAGMIDTRHPL 147 +E V P G+ CR+ GC+RRPIYA+KG T+A C HR A M++ RHPL Sbjct: 602 KETGTTVAPKGAQA--CRDVGCHRRPIYAFKGDTKALCCPIHRSAEMVNVRHPL 653 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig10346.379.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig10346.379.1 ID=prot_L-elsbetiae_contig10346.379.1|Name=mRNA_L-elsbetiae_contig10346.379.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=159bpback to top |