mRNA_L-elsbetiae_contig9786.18742.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9786.18742.1 vs. uniprot
Match: D7FJ03_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJ03_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 9.520e-15 Identity = 37/46 (80.43%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 1 FRSDVEVAFSSASLATIACNTLAVDAELQPDKIIRTLRVEGSSLRA 138 + D EV F SASLATIAC TLAVDAELQP+KIIRTLRVEGSSL A Sbjct: 5 YHCDAEVTFPSASLATIACRTLAVDAELQPNKIIRTLRVEGSSLLA 50
BLAST of mRNA_L-elsbetiae_contig9786.18742.1 vs. uniprot
Match: K3WQ75_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WQ75_GLOUD) HSP 1 Score: 48.1 bits (113), Expect = 5.320e-6 Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 1 Query: 1 FRSDVEVAFSSASLATIACNTLAVDAELQPDKIIRTLRVEGSSL 132 + D+ +AF A A A TL VDAELQPDKI RTL VEG++L Sbjct: 7 YECDISLAFPEAVDAAYALETLRVDAELQPDKITRTLAVEGTNL 50 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9786.18742.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9786.18742.1 >prot_L-elsbetiae_contig9786.18742.1 ID=prot_L-elsbetiae_contig9786.18742.1|Name=mRNA_L-elsbetiae_contig9786.18742.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=47bp FRSDVEVAFSSASLATIACNTLAVDAELQPDKIIRTLRVEGSSLRA*back to top mRNA from alignment at L-elsbetiae_contig9786:6564..6704+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9786.18742.1 ID=mRNA_L-elsbetiae_contig9786.18742.1|Name=mRNA_L-elsbetiae_contig9786.18742.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=141bp|location=Sequence derived from alignment at L-elsbetiae_contig9786:6564..6704+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9786:6564..6704+ >mRNA_L-elsbetiae_contig9786.18742.1 ID=mRNA_L-elsbetiae_contig9786.18742.1|Name=mRNA_L-elsbetiae_contig9786.18742.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=282bp|location=Sequence derived from alignment at L-elsbetiae_contig9786:6564..6704+ (Laminarionema elsbetiae ELsaHSoW15)back to top |