mRNA_L-elsbetiae_contig8814.17846.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Match: D7FLJ6_ECTSI (Asn/thr-rich large protein family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLJ6_ECTSI) HSP 1 Score: 68.2 bits (165), Expect = 2.010e-11 Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 2 Query: 2 LTGSTTFINNSAFWGGAIYNNIPDD----PETMTTFPGGTIFDGNEAENCPDVNNANVFDGNNENCPVV 196 L GSTTF N+AF GGAIY + D+ P ++TTFP T+F+ N AE+CPDV+N G+++NCPVV Sbjct: 318 LMGSTTFRENAAFMGGAIYTSDGDEENGEPASVTTFPDDTVFEDNSAEHCPDVHN-----GDSDNCPVV 381
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Match: D8LJ44_ECTSI (Asn/thr-rich large protein family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ44_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 1.210e-9 Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 2 Query: 2 LTGSTTFINNSAFWGGAIYNN----IPDDPETMTTFPGGTIFDGNEAENCPDVNNANVFDGNNENCPVV 196 L GSTTF N+A+ GGAIY + + ++TTFP T+F+ N A+ CPDV FDG+N+NCPVV Sbjct: 318 LMGSTTFRENAAYEGGAIYTDDGSVANGEAASVTTFPDDTVFEDNRADFCPDV-----FDGDNDNCPVV 381
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Match: D7FQG1_ECTSI (Polymorphic outer membrane protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQG1_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 7.100e-9 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 2 Query: 2 LTGSTTFINNSAFWGGAIYNNIPDD--PETMTTFPGGTIFDGNEAEN-CPDVNNANVFDGNNENCPVV 196 L G TTF N A+WGGAIY DD P ++TTFP T+F+ N A+ CPDV+N G++ NCPVV Sbjct: 113 LMGPTTFRENGAWWGGAIYT---DDGYPASVTTFPDDTVFEDNSADAYCPDVHN-----GDDNNCPVV 172 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8814.17846.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8814.17846.1 >prot_L-elsbetiae_contig8814.17846.1 ID=prot_L-elsbetiae_contig8814.17846.1|Name=mRNA_L-elsbetiae_contig8814.17846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=38bp MTTFPGGTIFDGNEAENCPDVNNANVFDGNNENCPVV*back to top mRNA from alignment at L-elsbetiae_contig8814:4899..6012+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8814.17846.1 ID=mRNA_L-elsbetiae_contig8814.17846.1|Name=mRNA_L-elsbetiae_contig8814.17846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1114bp|location=Sequence derived from alignment at L-elsbetiae_contig8814:4899..6012+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8814:4899..6012+ >mRNA_L-elsbetiae_contig8814.17846.1 ID=mRNA_L-elsbetiae_contig8814.17846.1|Name=mRNA_L-elsbetiae_contig8814.17846.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=228bp|location=Sequence derived from alignment at L-elsbetiae_contig8814:4899..6012+ (Laminarionema elsbetiae ELsaHSoW15)back to top |