mRNA_L-elsbetiae_contig88.17829.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig88.17829.1 vs. uniprot
Match: A0A6H5KF31_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KF31_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 6.240e-5 Identity = 39/86 (45.35%), Postives = 49/86 (56.98%), Query Frame = 1 Query: 862 MSELVELRGLVEATCEAVADQAKGSATISTEARELADEARASHGVVRAAKDSSCKALGLLETVVPAAFLSLENRLRKADDAVARVA 1119 MSEL ELR LVE T E V+DQ KG + +H + +AA SS K L +LET P+AFLSLE RL + ++ VA A Sbjct: 1 MSELSELRTLVETTHEIVSDQTKGLD-------------QGTHSLAKAASGSSSKVLNVLETTTPSAFLSLETRLSRVEETVAAAA 73 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig88.17829.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig88.17829.1 >prot_L-elsbetiae_contig88.17829.1 ID=prot_L-elsbetiae_contig88.17829.1|Name=mRNA_L-elsbetiae_contig88.17829.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=1009bp MDRNPIMSSSGRRRNVVKPGRIDTLLGNERDGLRLNFGLAMQMHRRSSYTback to top mRNA from alignment at L-elsbetiae_contig88:13583..37151+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig88.17829.1 ID=mRNA_L-elsbetiae_contig88.17829.1|Name=mRNA_L-elsbetiae_contig88.17829.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=23569bp|location=Sequence derived from alignment at L-elsbetiae_contig88:13583..37151+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig88:13583..37151+ >mRNA_L-elsbetiae_contig88.17829.1 ID=mRNA_L-elsbetiae_contig88.17829.1|Name=mRNA_L-elsbetiae_contig88.17829.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=6054bp|location=Sequence derived from alignment at L-elsbetiae_contig88:13583..37151+ (Laminarionema elsbetiae ELsaHSoW15)back to top |