mRNA_L-elsbetiae_contig876.17799.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig876.17799.1 vs. uniprot
Match: D7FRE8_ECTSI (EsV-1-166 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRE8_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 1.110e-9 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 1 Query: 1 ERHGTGNCYMGCDGDESVACGGFNSYSLFKYDKG-DPPITAPEPTSTPEPTPRPVA 165 ERHG G C+M C GD +VACGG+++YSLFKYD G + P TAP S PT P A Sbjct: 1307 ERHGEGVCHMACSGDGTVACGGYDAYSLFKYDNGGEAPTTAPVTDSPDTPTMAPTA 1362
BLAST of mRNA_L-elsbetiae_contig876.17799.1 vs. uniprot
Match: A0A6H5JJ37_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ37_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 3.060e-7 Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 1 ERHGTGNCYMGCDGDESVACGGFNSYSLFKYDKG 102 ERHG G C+M C GD +VACGG+++YSLFK+D G Sbjct: 961 ERHGEGVCHMACSGDGTVACGGYDAYSLFKHDNG 994 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig876.17799.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig876.17799.1 >prot_L-elsbetiae_contig876.17799.1 ID=prot_L-elsbetiae_contig876.17799.1|Name=mRNA_L-elsbetiae_contig876.17799.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=72bp MGCDGDESVACGGFNSYSLFKYDKGDPPITAPEPTSTPEPTPRPVAPVAPback to top mRNA from alignment at L-elsbetiae_contig876:15454..16007+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig876.17799.1 ID=mRNA_L-elsbetiae_contig876.17799.1|Name=mRNA_L-elsbetiae_contig876.17799.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=554bp|location=Sequence derived from alignment at L-elsbetiae_contig876:15454..16007+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig876:15454..16007+ >mRNA_L-elsbetiae_contig876.17799.1 ID=mRNA_L-elsbetiae_contig876.17799.1|Name=mRNA_L-elsbetiae_contig876.17799.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=432bp|location=Sequence derived from alignment at L-elsbetiae_contig876:15454..16007+ (Laminarionema elsbetiae ELsaHSoW15)back to top |