mRNA_L-elsbetiae_contig872.17747.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: D7FWL2_ECTSI (Pc21g14320 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWL2_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 1.390e-23 Identity = 44/54 (81.48%), Postives = 48/54 (88.89%), Query Frame = 3 Query: 3 REEEERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVYRS 164 R+EEERCK+C MGS+DALLLPCGHL C SCA VL VCPIC+ADIYRVQPVYRS Sbjct: 115 RQEEERCKICHMGSVDALLLPCGHLCACHSCASVLVVCPICRADIYRVQPVYRS 168
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A7K5WEX3_9SYLV (XIAP ligase (Fragment) n=1 Tax=Hylia prasina TaxID=208073 RepID=A0A7K5WEX3_9SYLV) HSP 1 Score: 62.0 bits (149), Expect = 2.650e-8 Identity = 22/51 (43.14%), Postives = 36/51 (70.59%), Query Frame = 3 Query: 6 EEEERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVY 158 +EE+ CK+C + + +PCGHL C+ CA +LS CP+C+ADI ++Q ++ Sbjct: 394 QEEKLCKICMAKDVSVVFIPCGHLVACKECAQLLSECPLCRADITKIQDIF 444
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A8J2R959_9NEOP ((African queen) hypothetical protein n=1 Tax=Danaus chrysippus TaxID=151541 RepID=A0A8J2R959_9NEOP) HSP 1 Score: 57.0 bits (136), Expect = 1.440e-6 Identity = 23/51 (45.10%), Postives = 32/51 (62.75%), Query Frame = 3 Query: 12 EERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVYRS 164 E+ CK+C L+ +LL CGH+ C SCA L+ CPIC+ + R V+RS Sbjct: 391 EDSCKICMAAPLECVLLECGHIAACTSCARQLAECPICRQYVVRAVRVFRS 441
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A6B2KW84_9EUKA (RING-type domain-containing protein n=1 Tax=Arcella intermedia TaxID=1963864 RepID=A0A6B2KW84_9EUKA) HSP 1 Score: 57.0 bits (136), Expect = 1.690e-6 Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 3 Query: 21 CKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVY 158 C++C+ +D ++L CGHL LC+ CAG + CPIC+ DI R + VY Sbjct: 1218 CRICYDRKIDVVILECGHLVLCEVCAGNVKKCPICRKDITRTKLVY 1263
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A2H1V888_SPOFR (SFRICE_001503 n=3 Tax=Spodoptera TaxID=7106 RepID=A0A2H1V888_SPOFR) HSP 1 Score: 55.5 bits (132), Expect = 4.960e-6 Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 3 Query: 12 EERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVYRS 164 EE CK+C L+ +LL CGH+ C SCA L+ CPIC+ + R +RS Sbjct: 408 EECCKICMAAPLECVLLECGHIAACTSCAKQLAECPICRQYVVRAVRFFRS 458
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A7I0YX93_DANPL (E3 ubiquitin-protein ligase RNF34 n=2 Tax=Danaus plexippus plexippus TaxID=278856 RepID=A0A7I0YX93_DANPL) HSP 1 Score: 55.1 bits (131), Expect = 6.560e-6 Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 3 Query: 12 EERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVYRS 164 E+ CK+C L+ +LL CGH+ C SCA L+ CPIC+ + R +RS Sbjct: 363 EDSCKICMAAPLECVLLECGHIAACTSCARQLAECPICRQYVVRAVRFFRS 413
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A2B4RII4_STYPI (Tumor susceptibility gene 101 protein n=2 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RII4_STYPI) HSP 1 Score: 53.9 bits (128), Expect = 1.040e-5 Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 3 Query: 6 EEEERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSV----CPICKADIYRVQPVYRS 164 E ++ C +C +++L+PCGHLGLC +CA + CP+C+ADI +V VY S Sbjct: 182 ESKKECIICMGEEPNSVLIPCGHLGLCITCAREVQRNSKRCPVCRADINQVHQVYES 238
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: F1KY53_ASCSU (RING finger and SPRY domain-containing protein 1 n=1 Tax=Ascaris suum TaxID=6253 RepID=F1KY53_ASCSU) HSP 1 Score: 53.5 bits (127), Expect = 2.410e-5 Identity = 19/42 (45.24%), Postives = 29/42 (69.05%), Query Frame = 3 Query: 12 EERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADI 137 ++ C +C+ S+D +L PCGH GLC SC+ L +CP+C+ I Sbjct: 500 DDSCHICYSSSIDTVLKPCGHSGLCFSCSEQLELCPLCRVHI 541
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: A0A6A5BJ22_NAEFO (Uncharacterized protein n=1 Tax=Naegleria fowleri TaxID=5763 RepID=A0A6A5BJ22_NAEFO) HSP 1 Score: 53.1 bits (126), Expect = 3.550e-5 Identity = 19/55 (34.55%), Postives = 39/55 (70.91%), Query Frame = 3 Query: 3 REEEERCKMCWMGSLDALLLPCGHLGLCQSCAGVLS--VCPICKADIYRVQPVYR 161 R+++++C +C G ++ +L+PCGH+ LC++CA L+ CP C+ +I ++ V++ Sbjct: 965 RQDQDQCVVCMDGEINVVLVPCGHMILCETCANQLTNKKCPTCRQNISQIVKVFK 1019
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Match: UPI00077A0D3D (mitochondrial ubiquitin ligase activator of NFKB 1-like n=2 Tax=Acropora TaxID=6127 RepID=UPI00077A0D3D) HSP 1 Score: 52.8 bits (125), Expect = 3.810e-5 Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 3 Query: 12 EERCKMCWMGSLDALLLPCGHLGLCQSCAGVLSVCPICKADIYRVQPVYRS 164 +E C +C + ++L CGH+ C CA ++ CP+C+ IYR+ P YRS Sbjct: 285 QEACVICMDRPRNVVILDCGHICCCLDCARQVNNCPVCRRQIYRLVPTYRS 335 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig872.17747.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 17
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig872.17747.1 >prot_L-elsbetiae_contig872.17747.1 ID=prot_L-elsbetiae_contig872.17747.1|Name=mRNA_L-elsbetiae_contig872.17747.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=98bp AGRRRSGARCAGWGRWTRSSCRAGTWVCASPAPGCSPCAPSARPTSTAFSback to top mRNA from alignment at L-elsbetiae_contig872:22878..23908- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig872.17747.1 ID=mRNA_L-elsbetiae_contig872.17747.1|Name=mRNA_L-elsbetiae_contig872.17747.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1031bp|location=Sequence derived from alignment at L-elsbetiae_contig872:22878..23908- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig872:22878..23908- >mRNA_L-elsbetiae_contig872.17747.1 ID=mRNA_L-elsbetiae_contig872.17747.1|Name=mRNA_L-elsbetiae_contig872.17747.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=588bp|location=Sequence derived from alignment at L-elsbetiae_contig872:22878..23908- (Laminarionema elsbetiae ELsaHSoW15)back to top |