mRNA_L-elsbetiae_contig8234.17239.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: D8LPW2_ECTSI (TPR repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LPW2_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 2.990e-13 Identity = 33/48 (68.75%), Postives = 38/48 (79.17%), Query Frame = 1 Query: 10 LHCRTRNPLDPQKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRA 153 +H R R L+ Q KYDE DPL++RAI+I E TLGPDHP LATSLNNRA Sbjct: 39 VHGRVRGLLESQGKYDEGDPLYLRAIEIGEKTLGPDHPALATSLNNRA 86
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: D8LLM3_ECTSI (Kinesin light chain-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLM3_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 4.440e-9 Identity = 26/39 (66.67%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 58 EADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQG 174 EADPL++RAI++ E LGPDHP+LAT LNN+A+LL+ QG Sbjct: 12 EADPLYLRAIEVGEKKLGPDHPDLATWLNNQAVLLRKQG 50
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: A0A6H5KSC7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSC7_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 5.860e-9 Identity = 29/46 (63.04%), Postives = 38/46 (82.61%), Query Frame = 1 Query: 34 LDPQKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQ 171 L+ Q K+ EADPL++RAI++ E LG DHP+LATS+NNRA LL+AQ Sbjct: 337 LEKQGKHAEADPLYLRAIEVAEKMLGRDHPDLATSINNRAELLRAQ 382
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: A0A6H5JUC1_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUC1_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 6.260e-9 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 52 YDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQG 174 + DPLF+RAI+I E TLGPDHP+LAT LNNRA LL+AQG Sbjct: 254 FTSQDPLFLRAIEIGEKTLGPDHPDLATRLNNRAELLRAQG 294
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: D7G6W2_ECTSI (NB-ARC and TPR repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6W2_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 9.300e-9 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 34 LDPQKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQ 171 L+ KY EADPL++RAI+I E TLGPDHP LAT LNNRA LL +Q Sbjct: 609 LELMGKYAEADPLYLRAIEIGENTLGPDHPALATQLNNRAGLLGSQ 654
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: UPI0013D29528 (tetratricopeptide repeat protein n=1 Tax=Desulfobacter hydrogenophilus TaxID=2291 RepID=UPI0013D29528) HSP 1 Score: 57.4 bits (137), Expect = 2.190e-8 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 37 DPQKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRA 153 + Q KY+EA+PL+ RA+KI+E LGPDHP +AT+LNN A Sbjct: 2 ESQGKYEEAEPLYQRALKIRETVLGPDHPSVATTLNNLA 40
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: A0A6H5J9V8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J9V8_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 4.170e-8 Identity = 27/43 (62.79%), Postives = 34/43 (79.07%), Query Frame = 1 Query: 43 QKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQ 171 Q KYD A+PL+VR++ I+E GPDHPE+ATSLNNRA L+ Q Sbjct: 395 QGKYDAAEPLYVRSLAIREKVYGPDHPEVATSLNNRAEFLRHQ 437
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: D7FHK2_ECTSI (Peptidase-like n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHK2_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 5.700e-8 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 49 KYDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQ 171 KY +ADP ++ AI+IQ+ TLGPDH +LAT+LN RA+LLK+Q Sbjct: 134 KYAQADPAYLEAIEIQQQTLGPDHADLATTLNGRALLLKSQ 174
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: A0A6H5L045_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L045_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 2.290e-7 Identity = 28/41 (68.29%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 49 KYDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQ 171 KY EADPL++RAI I + LGPDHP+LA LNNRA LLK Q Sbjct: 11 KYAEADPLYLRAIDIGKKMLGPDHPDLAAWLNNRAGLLKKQ 51
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Match: A0A6H5K3K8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3K8_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 2.560e-7 Identity = 26/45 (57.78%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 37 DPQKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRAILLKAQ 171 D Q KY EA+PL+ R+ IQE LG +HP++A+SLNNR LL+AQ Sbjct: 16 DIQGKYMEAEPLYERSQAIQEKVLGLEHPDVASSLNNRVELLRAQ 60 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8234.17239.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8234.17239.1 >prot_L-elsbetiae_contig8234.17239.1 ID=prot_L-elsbetiae_contig8234.17239.1|Name=mRNA_L-elsbetiae_contig8234.17239.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=137bp MISLHCRTRNPLDPQKKYDEADPLFVRAIKIQEATLGPDHPELATSLNNRback to top mRNA from alignment at L-elsbetiae_contig8234:4237..5213- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8234.17239.1 ID=mRNA_L-elsbetiae_contig8234.17239.1|Name=mRNA_L-elsbetiae_contig8234.17239.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=977bp|location=Sequence derived from alignment at L-elsbetiae_contig8234:4237..5213- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8234:4237..5213- >mRNA_L-elsbetiae_contig8234.17239.1 ID=mRNA_L-elsbetiae_contig8234.17239.1|Name=mRNA_L-elsbetiae_contig8234.17239.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=822bp|location=Sequence derived from alignment at L-elsbetiae_contig8234:4237..5213- (Laminarionema elsbetiae ELsaHSoW15)back to top |