mRNA_L-elsbetiae_contig761.16529.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig761.16529.1 vs. uniprot
Match: A0A6H5KUI1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUI1_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 6.400e-6 Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1 Query: 220 ISEQELFAPLRSGLPPTDAPVRIPTATGR 306 +SE+ELFAPLRSGLP TD PVRIPTAT R Sbjct: 264 VSEEELFAPLRSGLPSTDTPVRIPTATAR 292
BLAST of mRNA_L-elsbetiae_contig761.16529.1 vs. uniprot
Match: D7G1J2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1J2_ECTSI) HSP 1 Score: 53.1 bits (126), Expect = 7.220e-6 Identity = 24/29 (82.76%), Postives = 26/29 (89.66%), Query Frame = 1 Query: 220 ISEQELFAPLRSGLPPTDAPVRIPTATGR 306 +SE+ELFAPLRSGLP TD PVRIPTAT R Sbjct: 1292 VSEEELFAPLRSGLPSTDTPVRIPTATAR 1320 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig761.16529.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig761.16529.1 >prot_L-elsbetiae_contig761.16529.1 ID=prot_L-elsbetiae_contig761.16529.1|Name=mRNA_L-elsbetiae_contig761.16529.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bp GYGQQPDVRQGRHEQSSSTETDQKYLRVMQRREQDEAVRRNAVPAGGNRSback to top mRNA from alignment at L-elsbetiae_contig761:5061..6199- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig761.16529.1 ID=mRNA_L-elsbetiae_contig761.16529.1|Name=mRNA_L-elsbetiae_contig761.16529.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1139bp|location=Sequence derived from alignment at L-elsbetiae_contig761:5061..6199- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig761:5061..6199- >mRNA_L-elsbetiae_contig761.16529.1 ID=mRNA_L-elsbetiae_contig761.16529.1|Name=mRNA_L-elsbetiae_contig761.16529.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=624bp|location=Sequence derived from alignment at L-elsbetiae_contig761:5061..6199- (Laminarionema elsbetiae ELsaHSoW15)back to top |