mRNA_L-elsbetiae_contig7600.16517.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: D7G3Z3_ECTSI (1-phosphatidylinositol-3-phosphate 5-kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3Z3_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 1.450e-9 Identity = 32/38 (84.21%), Postives = 36/38 (94.74%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVK 114 VDKIVAL P++LLV+KTVSGLAQDLLRQ G+TLVQNVK Sbjct: 502 VDKIVALRPHLLLVSKTVSGLAQDLLRQHGVTLVQNVK 539
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182HNX8_ANOAR (Anaphase-promoting complex subunit 13 n=2 Tax=gambiae species complex TaxID=44542 RepID=A0A182HNX8_ANOAR) HSP 1 Score: 55.1 bits (131), Expect = 1.160e-7 Identity = 26/41 (63.41%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR +GITLV +VK+CV Sbjct: 562 VSKIISLGPNIVLVHKNVAGIAQDMLRNKGITLVLDVKLCV 602
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: Q7PQ30_ANOGA (Anaphase-promoting complex subunit 13 n=8 Tax=gambiae species complex TaxID=44542 RepID=Q7PQ30_ANOGA) HSP 1 Score: 55.1 bits (131), Expect = 1.160e-7 Identity = 26/41 (63.41%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR +GITLV +VK+CV Sbjct: 495 VSKIISLGPNIVLVHKNVAGIAQDMLRNKGITLVLDVKLCV 535
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182P8S8_9DIPT (Anaphase-promoting complex subunit 13 n=2 Tax=Pyretophorus TaxID=44537 RepID=A0A182P8S8_9DIPT) HSP 1 Score: 54.3 bits (129), Expect = 2.160e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 662 VSKIISLGPNIVLVHKNVAGIAQDMLRNNGITLVLDVKLCV 702
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182J6H3_9DIPT (1-phosphatidylinositol-3-phosphate 5-kinase n=1 Tax=Anopheles atroparvus TaxID=41427 RepID=A0A182J6H3_9DIPT) HSP 1 Score: 54.3 bits (129), Expect = 2.160e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 612 VSKIISLGPNIVLVHKNVAGIAQDMLRNNGITLVLDVKLCV 652
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182YC39_ANOST (1-phosphatidylinositol-3-phosphate 5-kinase n=2 Tax=Anopheles stephensi TaxID=30069 RepID=A0A182YC39_ANOST) HSP 1 Score: 54.3 bits (129), Expect = 2.160e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 576 VSKIISLGPNIVLVHKNVAGIAQDMLRNNGITLVLDVKLCV 616
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A084WCQ2_ANOSI (1-phosphatidylinositol-3-phosphate 5-kinase n=1 Tax=Anopheles sinensis TaxID=74873 RepID=A0A084WCQ2_ANOSI) HSP 1 Score: 54.3 bits (129), Expect = 2.160e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 585 VSKIISLGPNIVLVHKNVAGIAQDMLRNNGITLVLDVKLCV 625
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182T0G6_9DIPT (FYVE-type domain-containing protein n=1 Tax=Anopheles maculatus TaxID=74869 RepID=A0A182T0G6_9DIPT) HSP 1 Score: 54.3 bits (129), Expect = 2.170e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 576 VSKIISLGPNIVLVHKNVAGIAQDMLRNNGITLVLDVKLCV 616
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182WK22_9DIPT (Anaphase-promoting complex subunit 13 n=2 Tax=Myzomyia TaxID=59140 RepID=A0A182WK22_9DIPT) HSP 1 Score: 53.9 bits (128), Expect = 2.960e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 699 VSKIISLGPNIVLVHKNVAGIAQDMLRNSGITLVLDVKLCV 739
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Match: A0A182MLP5_9DIPT (Anaphase-promoting complex subunit 13 n=1 Tax=Anopheles culicifacies TaxID=139723 RepID=A0A182MLP5_9DIPT) HSP 1 Score: 53.9 bits (128), Expect = 2.960e-7 Identity = 26/41 (63.41%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCV 123 V KI++LGPN++LV K V+G+AQD+LR GITLV +VK+CV Sbjct: 563 VSKIISLGPNIVLVHKNVAGIAQDMLRNSGITLVLDVKLCV 603 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7600.16517.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7600.16517.1 >prot_L-elsbetiae_contig7600.16517.1 ID=prot_L-elsbetiae_contig7600.16517.1|Name=mRNA_L-elsbetiae_contig7600.16517.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=41bp VDKIVALGPNVLLVTKTVSGLAQDLLRQRGITLVQNVKVCVback to top mRNA from alignment at L-elsbetiae_contig7600:316..438+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7600.16517.1 ID=mRNA_L-elsbetiae_contig7600.16517.1|Name=mRNA_L-elsbetiae_contig7600.16517.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=123bp|location=Sequence derived from alignment at L-elsbetiae_contig7600:316..438+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7600:316..438+ >mRNA_L-elsbetiae_contig7600.16517.1 ID=mRNA_L-elsbetiae_contig7600.16517.1|Name=mRNA_L-elsbetiae_contig7600.16517.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=246bp|location=Sequence derived from alignment at L-elsbetiae_contig7600:316..438+ (Laminarionema elsbetiae ELsaHSoW15)back to top |