mRNA_L-elsbetiae_contig7557.16453.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7557.16453.1 vs. uniprot
Match: D7FNA1_ECTSI (PPR_long domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNA1_ECTSI) HSP 1 Score: 87.4 bits (215), Expect = 5.660e-19 Identity = 38/44 (86.36%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 1 QVQRLSWFANWFDSLEDPPTAIIDGPNAGYMGQNFPEGGFSLTQ 132 +VQRLSWFANWF SLEDPPTAIIDGPN G+M QNF EGGFSLTQ Sbjct: 513 EVQRLSWFANWFCSLEDPPTAIIDGPNVGFMNQNFKEGGFSLTQ 556
BLAST of mRNA_L-elsbetiae_contig7557.16453.1 vs. uniprot
Match: A0A6H5JYJ8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYJ8_9PHAE) HSP 1 Score: 81.6 bits (200), Expect = 1.520e-17 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 1 Query: 4 VQRLSWFANWFDSLEDPPTAIIDGPNAGYMGQNFPEGGFSLTQA 135 VQRLSWFANWF SLEDPPTAIIDGPN G+M QNF GG S TQA Sbjct: 174 VQRLSWFANWFCSLEDPPTAIIDGPNVGFMNQNFKGGGLSFTQA 217 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7557.16453.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7557.16453.1 >prot_L-elsbetiae_contig7557.16453.1 ID=prot_L-elsbetiae_contig7557.16453.1|Name=mRNA_L-elsbetiae_contig7557.16453.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=45bp QVQRLSWFANWFDSLEDPPTAIIDGPNAGYMGQNFPEGGFSLTQAback to top mRNA from alignment at L-elsbetiae_contig7557:403..538+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7557.16453.1 ID=mRNA_L-elsbetiae_contig7557.16453.1|Name=mRNA_L-elsbetiae_contig7557.16453.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=136bp|location=Sequence derived from alignment at L-elsbetiae_contig7557:403..538+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7557:403..538+ >mRNA_L-elsbetiae_contig7557.16453.1 ID=mRNA_L-elsbetiae_contig7557.16453.1|Name=mRNA_L-elsbetiae_contig7557.16453.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=270bp|location=Sequence derived from alignment at L-elsbetiae_contig7557:403..538+ (Laminarionema elsbetiae ELsaHSoW15)back to top |