mRNA_L-elsbetiae_contig7334.16207.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7334.16207.1 vs. uniprot
Match: Q8QN73_ESV1K (EsV-1-217 n=2 Tax=root TaxID=1 RepID=Q8QN73_ESV1K) HSP 1 Score: 52.8 bits (125), Expect = 7.100e-5 Identity = 28/63 (44.44%), Postives = 37/63 (58.73%), Query Frame = 1 Query: 178 CKGATLGDLHHVMHLAVPEVREMIYFTSKDYSDRRQAMISMWYNLRKHLLFCNKKHFESSKNK 366 C L + M AVP EM TS +S RR+ M S W +LRK+L+ C+KK+FES+K K Sbjct: 107 CTDTNLMAIRQAMMAAVPTALEMRGLTSAAFSRRRETMSSTWTSLRKYLVACHKKNFESAKKK 169 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7334.16207.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7334.16207.1 >prot_L-elsbetiae_contig7334.16207.1 ID=prot_L-elsbetiae_contig7334.16207.1|Name=mRNA_L-elsbetiae_contig7334.16207.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=201bp MALKQKAREEKEKNKAGKKEMNEQKKINSQLKKELDIKNAREKKANQEKTback to top mRNA from alignment at L-elsbetiae_contig7334:609..1226+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7334.16207.1 ID=mRNA_L-elsbetiae_contig7334.16207.1|Name=mRNA_L-elsbetiae_contig7334.16207.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=618bp|location=Sequence derived from alignment at L-elsbetiae_contig7334:609..1226+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7334:609..1226+ >mRNA_L-elsbetiae_contig7334.16207.1 ID=mRNA_L-elsbetiae_contig7334.16207.1|Name=mRNA_L-elsbetiae_contig7334.16207.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1206bp|location=Sequence derived from alignment at L-elsbetiae_contig7334:609..1226+ (Laminarionema elsbetiae ELsaHSoW15)back to top |