mRNA_L-elsbetiae_contig7207.16056.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7207.16056.1 vs. uniprot
Match: D7FZI4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZI4_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 4.680e-10 Identity = 30/39 (76.92%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 229 LQALVRMGLLTPNLDSPMHSCWTNTKHCNAKTARPCQVC 345 + ALVRMGLLT NLDSPMHS WTN KH NAKT R CQ C Sbjct: 117 ITALVRMGLLTANLDSPMHSLWTNQKHHNAKTERACQAC 155
BLAST of mRNA_L-elsbetiae_contig7207.16056.1 vs. uniprot
Match: D7FWW9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWW9_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 4.150e-9 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 235 ALVRMGLLTPNLDSPMHSCWTNTKHCNAKTARPCQVC 345 ALVR+GLLT NLDSP+HS WTN KH NAKT R CQ C Sbjct: 25 ALVRLGLLTANLDSPLHSLWTNQKHHNAKTERACQAC 61
BLAST of mRNA_L-elsbetiae_contig7207.16056.1 vs. uniprot
Match: A0A6H5KPX4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPX4_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 3.150e-7 Identity = 27/38 (71.05%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 232 QALVRMGLLTPNLDSPMHSCWTNTKHCNAKTARPCQVC 345 +ALVR+GLLT NLDSPMHS W N KH NAKT CQ C Sbjct: 21 EALVRLGLLTANLDSPMHSLWANQKHHNAKTT--CQAC 56 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7207.16056.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7207.16056.1 >prot_L-elsbetiae_contig7207.16056.1 ID=prot_L-elsbetiae_contig7207.16056.1|Name=mRNA_L-elsbetiae_contig7207.16056.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=115bp LEPGFIVWNLLVGNSPPSSSRGGDRCVRTLELMFCPGRTCESFVQTAHRAback to top mRNA from alignment at L-elsbetiae_contig7207:4347..4692+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7207.16056.1 ID=mRNA_L-elsbetiae_contig7207.16056.1|Name=mRNA_L-elsbetiae_contig7207.16056.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=346bp|location=Sequence derived from alignment at L-elsbetiae_contig7207:4347..4692+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7207:4347..4692+ >mRNA_L-elsbetiae_contig7207.16056.1 ID=mRNA_L-elsbetiae_contig7207.16056.1|Name=mRNA_L-elsbetiae_contig7207.16056.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=690bp|location=Sequence derived from alignment at L-elsbetiae_contig7207:4347..4692+ (Laminarionema elsbetiae ELsaHSoW15)back to top |