mRNA_L-elsbetiae_contig7113.15926.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7113.15926.1 vs. uniprot
Match: A0A6H5JG88_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JG88_9PHAE) HSP 1 Score: 104 bits (260), Expect = 2.120e-23 Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = -2 Query: 10 RPFDLKQPPRITRIQRLVPFVLAAINALASSRKVLPSPVPVPLVAEPSADSTCSTLAAAFHDARP 204 RPFDLKQP RI RIQRL PFV+ AINALASSR+VLPSPVPVPL+A+PSA ST ST+ AAFHDARP Sbjct: 103 RPFDLKQPLRINRIQRLFPFVVTAINALASSREVLPSPVPVPLIAKPSAASTASTITAAFHDARP 167
BLAST of mRNA_L-elsbetiae_contig7113.15926.1 vs. uniprot
Match: D8LL82_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LL82_ECTSI) HSP 1 Score: 100 bits (249), Expect = 7.390e-22 Identity = 52/67 (77.61%), Postives = 58/67 (86.57%), Query Frame = -2 Query: 4 RPFDLKQPPRITRIQRLVPFVLAAINALASSRKVLPSPVPVPLVAEPSADSTCSTLAAAFHDARPAL 204 RPFDLKQP RI RIQRL PFV+ AINALASSR+VLPSPV VPL+AEP+A ST ST+ AA HDARP+L Sbjct: 87 RPFDLKQPLRINRIQRLFPFVVTAINALASSREVLPSPVSVPLMAEPAAASTASTVTAALHDARPSL 153 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7113.15926.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7113.15926.1 >prot_L-elsbetiae_contig7113.15926.1 ID=prot_L-elsbetiae_contig7113.15926.1|Name=mRNA_L-elsbetiae_contig7113.15926.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=107bp MRVIRGGCFRSNGRVERPAPHQHLPGVSADGGGGVRPANANAVTIQSRRMback to top mRNA from alignment at L-elsbetiae_contig7113:944..1427+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7113.15926.1 ID=mRNA_L-elsbetiae_contig7113.15926.1|Name=mRNA_L-elsbetiae_contig7113.15926.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=484bp|location=Sequence derived from alignment at L-elsbetiae_contig7113:944..1427+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7113:944..1427+ >mRNA_L-elsbetiae_contig7113.15926.1 ID=mRNA_L-elsbetiae_contig7113.15926.1|Name=mRNA_L-elsbetiae_contig7113.15926.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=642bp|location=Sequence derived from alignment at L-elsbetiae_contig7113:944..1427+ (Laminarionema elsbetiae ELsaHSoW15)back to top |