mRNA_L-elsbetiae_contig70.15795.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig70.15795.1 vs. uniprot
Match: A0A6H5KUW2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUW2_9PHAE) HSP 1 Score: 95.5 bits (236), Expect = 1.200e-20 Identity = 44/47 (93.62%), Postives = 46/47 (97.87%), Query Frame = 2 Query: 5 PAALSTEKRDQLYAQLVDMGFAIADCDRAFKEVGYEIDPVLNWLFSS 145 PAALS EKRDQLYAQLVDMGFAIADCD+AFKEVGYEIDPVLNWLFS+ Sbjct: 1800 PAALSAEKRDQLYAQLVDMGFAIADCDKAFKEVGYEIDPVLNWLFSN 1846
BLAST of mRNA_L-elsbetiae_contig70.15795.1 vs. uniprot
Match: D7G4G1_ECTSI (Heat shock protein 40 like protein/ DnaJ domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4G1_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 1.050e-9 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 2 Query: 5 PAALSTEKRDQLYAQLVDMGFAIADCDRAFKE 100 PAALS EKRDQLYAQLVDMGFAIADCD+AFKE Sbjct: 1860 PAALSAEKRDQLYAQLVDMGFAIADCDKAFKE 1891 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig70.15795.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig70.15795.1 >prot_L-elsbetiae_contig70.15795.1 ID=prot_L-elsbetiae_contig70.15795.1|Name=mRNA_L-elsbetiae_contig70.15795.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=63bp GPRGAFDGEERPAVRPACGHGLRDSRLRPCFQGGGLRDRSSPELAVLQRLback to top mRNA from alignment at L-elsbetiae_contig70:25026..25925- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig70.15795.1 ID=mRNA_L-elsbetiae_contig70.15795.1|Name=mRNA_L-elsbetiae_contig70.15795.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=900bp|location=Sequence derived from alignment at L-elsbetiae_contig70:25026..25925- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig70:25026..25925- >mRNA_L-elsbetiae_contig70.15795.1 ID=mRNA_L-elsbetiae_contig70.15795.1|Name=mRNA_L-elsbetiae_contig70.15795.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=378bp|location=Sequence derived from alignment at L-elsbetiae_contig70:25026..25925- (Laminarionema elsbetiae ELsaHSoW15)back to top |