mRNA_L-elsbetiae_contig6610.15334.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6610.15334.1 vs. uniprot
Match: D7FS70_ECTSI (Vacuolar protein sorting vps16 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS70_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 8.090e-10 Identity = 34/44 (77.27%), Postives = 34/44 (77.27%), Query Frame = 1 Query: 37 G*DVEL*ATGDIGRTRIPQAEDRYDLYLENKSWEKAAEAAARLK 168 G D E TG I RIPQAEDRYDLYLENKSWEKAAE AARLK Sbjct: 514 GDDTERYITGYI--ERIPQAEDRYDLYLENKSWEKAAEVAARLK 555
BLAST of mRNA_L-elsbetiae_contig6610.15334.1 vs. uniprot
Match: A0A6H5KVY1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVY1_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 8.130e-10 Identity = 34/44 (77.27%), Postives = 34/44 (77.27%), Query Frame = 1 Query: 37 G*DVEL*ATGDIGRTRIPQAEDRYDLYLENKSWEKAAEAAARLK 168 G D E TG I RIPQAEDRYDLYLENKSWEKAAE AARLK Sbjct: 779 GDDTERYITGYI--ERIPQAEDRYDLYLENKSWEKAAEVAARLK 820 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6610.15334.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6610.15334.1 >prot_L-elsbetiae_contig6610.15334.1 ID=prot_L-elsbetiae_contig6610.15334.1|Name=mRNA_L-elsbetiae_contig6610.15334.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=38bp MVCERTAFRVARTWSFEPQVTSAGREYLRRKTGTTCT*back to top mRNA from alignment at L-elsbetiae_contig6610:9462..9863- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6610.15334.1 ID=mRNA_L-elsbetiae_contig6610.15334.1|Name=mRNA_L-elsbetiae_contig6610.15334.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=402bp|location=Sequence derived from alignment at L-elsbetiae_contig6610:9462..9863- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6610:9462..9863- >mRNA_L-elsbetiae_contig6610.15334.1 ID=mRNA_L-elsbetiae_contig6610.15334.1|Name=mRNA_L-elsbetiae_contig6610.15334.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=228bp|location=Sequence derived from alignment at L-elsbetiae_contig6610:9462..9863- (Laminarionema elsbetiae ELsaHSoW15)back to top |