mRNA_L-elsbetiae_contig5759.14166.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5759.14166.1 vs. uniprot
Match: D8LNJ8_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNJ8_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 1.040e-5 Identity = 21/39 (53.85%), Postives = 26/39 (66.67%), Query Frame = 1 Query: 1 MVDVLRKRCRHAECTTSPSFGVPGSNTAIFCAKHAEEGM 117 M+DV+ KRC H+ C PS+G+P S A FCA HA GM Sbjct: 1 MIDVVSKRCAHSGCNKWPSYGMPPSKKAEFCANHARPGM 39
BLAST of mRNA_L-elsbetiae_contig5759.14166.1 vs. uniprot
Match: A0A6H5LBM3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LBM3_9PHAE) HSP 1 Score: 48.1 bits (113), Expect = 2.870e-5 Identity = 20/40 (50.00%), Postives = 27/40 (67.50%), Query Frame = 1 Query: 1 MVDVLR-KRCRHAECTTSPSFGVPGSNTAIFCAKHAEEGM 117 MVD+ +RC H +C P++GVPG+ A FCA HA +GM Sbjct: 8 MVDIHNIRRCAHEDCVKHPTYGVPGTRKAEFCAPHALDGM 47 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5759.14166.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5759.14166.1 >prot_L-elsbetiae_contig5759.14166.1 ID=prot_L-elsbetiae_contig5759.14166.1|Name=mRNA_L-elsbetiae_contig5759.14166.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=91bp MVDVLRKRCRHAECTTSPSFGVPGSNTAIFCAKHAEEGMADVRNKKCGFKback to top mRNA from alignment at L-elsbetiae_contig5759:8345..8617+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5759.14166.1 ID=mRNA_L-elsbetiae_contig5759.14166.1|Name=mRNA_L-elsbetiae_contig5759.14166.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=273bp|location=Sequence derived from alignment at L-elsbetiae_contig5759:8345..8617+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5759:8345..8617+ >mRNA_L-elsbetiae_contig5759.14166.1 ID=mRNA_L-elsbetiae_contig5759.14166.1|Name=mRNA_L-elsbetiae_contig5759.14166.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=546bp|location=Sequence derived from alignment at L-elsbetiae_contig5759:8345..8617+ (Laminarionema elsbetiae ELsaHSoW15)back to top |