mRNA_L-elsbetiae_contig564.13980.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig564.13980.1 vs. uniprot
Match: D7G0C1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0C1_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 2.150e-17 Identity = 39/44 (88.64%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 1 VILSASSPDDEALVLGAKYFGFEFINRIDSNAILHTWDVTAPPS 132 V+LSASSPDDEALVLGAKYFGFEF+NRIDS+AILHTWDV+ PPS Sbjct: 656 VMLSASSPDDEALVLGAKYFGFEFVNRIDSSAILHTWDVSTPPS 699
BLAST of mRNA_L-elsbetiae_contig564.13980.1 vs. uniprot
Match: A0A6H5JC88_9PHAE (PhoLip_ATPase_N domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC88_9PHAE) HSP 1 Score: 84.3 bits (207), Expect = 1.010e-16 Identity = 38/44 (86.36%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 1 VILSASSPDDEALVLGAKYFGFEFINRIDSNAILHTWDVTAPPS 132 V+LSASSPDDEALVLGAKYFGFEF+NRIDS+AILHTWD + PPS Sbjct: 599 VMLSASSPDDEALVLGAKYFGFEFVNRIDSSAILHTWDFSTPPS 642
BLAST of mRNA_L-elsbetiae_contig564.13980.1 vs. uniprot
Match: A0A836CFX1_9STRA (Phospholipid-transporting ATPase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CFX1_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 4.950e-9 Identity = 29/42 (69.05%), Postives = 35/42 (83.33%), Query Frame = 1 Query: 1 VILSASSPDDEALVLGAKYFGFEFINRIDSNAILHTWDVTAP 126 V+LSASSPDDEALVLGAKYFGFEF++R D+ A++ V AP Sbjct: 603 VVLSASSPDDEALVLGAKYFGFEFLDRADTTALIRRTVVHAP 644
BLAST of mRNA_L-elsbetiae_contig564.13980.1 vs. uniprot
Match: D7FU89_ECTSI (Phospholipid-transporting ATPase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FU89_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 6.060e-8 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 VILSASSPDDEALVLGAKYFGFEFINRIDSNAILHTWDVTAPPSSS 138 ++LSASSPDDEALVLGAKYFG EF RID+ A++ + +P S S Sbjct: 566 IVLSASSPDDEALVLGAKYFGVEFTERIDTTAVIRRTPMPSPLSPS 611
BLAST of mRNA_L-elsbetiae_contig564.13980.1 vs. uniprot
Match: A0A7S1Y0K7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1Y0K7_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 2.740e-5 Identity = 25/36 (69.44%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 VILSASSPDDEALVLGAKYFGFEFINRIDSNAILHT 108 V SASSPDDEALV GAKYFG+ F +RID AI+ T Sbjct: 8 VKFSASSPDDEALVCGAKYFGYFFKDRIDGKAIIET 43 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig564.13980.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig564.13980.1 >prot_L-elsbetiae_contig564.13980.1 ID=prot_L-elsbetiae_contig564.13980.1|Name=mRNA_L-elsbetiae_contig564.13980.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=110bp VILSASSPDDEALVLGAKYFGFEFINRIDSNAILHTWDVTAPPSSSSSLSback to top mRNA from alignment at L-elsbetiae_contig564:2331..2660+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig564.13980.1 ID=mRNA_L-elsbetiae_contig564.13980.1|Name=mRNA_L-elsbetiae_contig564.13980.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=330bp|location=Sequence derived from alignment at L-elsbetiae_contig564:2331..2660+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig564:2331..2660+ >mRNA_L-elsbetiae_contig564.13980.1 ID=mRNA_L-elsbetiae_contig564.13980.1|Name=mRNA_L-elsbetiae_contig564.13980.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=660bp|location=Sequence derived from alignment at L-elsbetiae_contig564:2331..2660+ (Laminarionema elsbetiae ELsaHSoW15)back to top |