mRNA_L-elsbetiae_contig560.13924.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig560.13924.1 vs. uniprot
Match: D7FH20_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH20_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 7.230e-13 Identity = 42/60 (70.00%), Postives = 48/60 (80.00%), Query Frame = 3 Query: 1215 ASGLCRASLTNLDEVAGRGQLCAIVWLSDRGAGASTLAVDRAASAGHADVVGYLLRNRQE 1394 ASG+CRASL NLDEVA GQL A++WLS+RGA AST AVDRAA AGH V YLL +R+E Sbjct: 208 ASGICRASLANLDEVAREGQLRALIWLSERGARASTSAVDRAAEAGHLGTVEYLLHHRRE 267
BLAST of mRNA_L-elsbetiae_contig560.13924.1 vs. uniprot
Match: A0A6H5JRB1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRB1_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 1.420e-11 Identity = 40/62 (64.52%), Postives = 47/62 (75.81%), Query Frame = 3 Query: 1209 LDASGLCRASLTNLDEVAGRGQLCAIVWLSDRGAGASTLAVDRAASAGHADVVGYLLRNRQE 1394 L SG+CRASL NLDEVA GQL A++WL++R A AST AVDRAA AGH V YLL +R+E Sbjct: 158 LHDSGICRASLANLDEVAREGQLRALIWLNERDARASTSAVDRAAEAGHLGTVEYLLHHRRE 219 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig560.13924.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig560.13924.1 >prot_L-elsbetiae_contig560.13924.1 ID=prot_L-elsbetiae_contig560.13924.1|Name=mRNA_L-elsbetiae_contig560.13924.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=635bp MAALFSQVMEAPELVTACMAYQDGVQMAMYEDGDVAACSGHLSLLRLRRAback to top mRNA from alignment at L-elsbetiae_contig560:5508..11160- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig560.13924.1 ID=mRNA_L-elsbetiae_contig560.13924.1|Name=mRNA_L-elsbetiae_contig560.13924.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=5653bp|location=Sequence derived from alignment at L-elsbetiae_contig560:5508..11160- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig560:5508..11160- >mRNA_L-elsbetiae_contig560.13924.1 ID=mRNA_L-elsbetiae_contig560.13924.1|Name=mRNA_L-elsbetiae_contig560.13924.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=3810bp|location=Sequence derived from alignment at L-elsbetiae_contig560:5508..11160- (Laminarionema elsbetiae ELsaHSoW15)back to top |