mRNA_L-elsbetiae_contig5530.13822.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5530.13822.1 vs. uniprot
Match: D7G8Q6_ECTSI (Mediator of RNA polymerase II transcription subunit 20 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8Q6_ECTSI) HSP 1 Score: 49.3 bits (116), Expect = 4.650e-5 Identity = 21/27 (77.78%), Postives = 24/27 (88.89%), Query Frame = 1 Query: 4 MRFGVNTAAPFVGMKREEGSDYPFAKQ 84 M+ GVN AAPFVGMK+EEG +YPFAKQ Sbjct: 1 MKHGVNLAAPFVGMKKEEGIEYPFAKQ 27 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5530.13822.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5530.13822.1 >prot_L-elsbetiae_contig5530.13822.1 ID=prot_L-elsbetiae_contig5530.13822.1|Name=mRNA_L-elsbetiae_contig5530.13822.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bp MRFGVNTAAPFVGMKREEGSDYPFAKQVNSRHVLTFVRNAV*back to top mRNA from alignment at L-elsbetiae_contig5530:6583..6851+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5530.13822.1 ID=mRNA_L-elsbetiae_contig5530.13822.1|Name=mRNA_L-elsbetiae_contig5530.13822.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=269bp|location=Sequence derived from alignment at L-elsbetiae_contig5530:6583..6851+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5530:6583..6851+ >mRNA_L-elsbetiae_contig5530.13822.1 ID=mRNA_L-elsbetiae_contig5530.13822.1|Name=mRNA_L-elsbetiae_contig5530.13822.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=252bp|location=Sequence derived from alignment at L-elsbetiae_contig5530:6583..6851+ (Laminarionema elsbetiae ELsaHSoW15)back to top |