mRNA_L-elsbetiae_contig5451.13708.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5451.13708.1 vs. uniprot
Match: A0A6H5K451_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K451_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 7.300e-9 Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = -1 Query: 577 GAVDQDAYGKNGVLREADYFNKQREFEV 660 GAVDQDAYGKNGVLREADYFNKQREFEV Sbjct: 3 GAVDQDAYGKNGVLREADYFNKQREFEV 30
BLAST of mRNA_L-elsbetiae_contig5451.13708.1 vs. uniprot
Match: D8LIQ9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LIQ9_ECTSI) HSP 1 Score: 60.8 bits (146), Expect = 5.240e-8 Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = -1 Query: 577 GAVDQDAYGKNGVLREADYFNKQREFEV 660 GAVDQDAYGKNGVLREADYFNKQREFEV Sbjct: 3 GAVDQDAYGKNGVLREADYFNKQREFEV 30 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5451.13708.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5451.13708.1 >prot_L-elsbetiae_contig5451.13708.1 ID=prot_L-elsbetiae_contig5451.13708.1|Name=mRNA_L-elsbetiae_contig5451.13708.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=220bp VAESVKKIKAQAATSRAEAWLFLDPSSQWYRIRLVFRPFPSLPTLHHYLRback to top mRNA from alignment at L-elsbetiae_contig5451:11168..11827+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5451.13708.1 ID=mRNA_L-elsbetiae_contig5451.13708.1|Name=mRNA_L-elsbetiae_contig5451.13708.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=660bp|location=Sequence derived from alignment at L-elsbetiae_contig5451:11168..11827+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5451:11168..11827+ >mRNA_L-elsbetiae_contig5451.13708.1 ID=mRNA_L-elsbetiae_contig5451.13708.1|Name=mRNA_L-elsbetiae_contig5451.13708.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1320bp|location=Sequence derived from alignment at L-elsbetiae_contig5451:11168..11827+ (Laminarionema elsbetiae ELsaHSoW15)back to top |