mRNA_L-elsbetiae_contig5328.13493.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5328.13493.1 vs. uniprot
Match: D8LJE2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJE2_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 1.380e-7 Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 1 Query: 40 GHQAQVKCLSIDSRGELLVSGDESGSICARLLHPRQSHSSSPRGWGT 180 G + +V CLSID RGELLV+GDESG+ICARLLH HS + G GT Sbjct: 12 GRRQKVGCLSIDRRGELLVTGDESGAICARLLH----HSGNRSGDGT 54
BLAST of mRNA_L-elsbetiae_contig5328.13493.1 vs. uniprot
Match: A0A6H5L2I0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2I0_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 1.680e-6 Identity = 29/42 (69.05%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 55 VKCLSIDSRGELLVSGDESGSICARLLHPRQSHSSSPRGWGT 180 V CLSID RGELLV+GDESG+ICARLLH HS + G GT Sbjct: 5 VGCLSIDRRGELLVTGDESGAICARLLH----HSGNRSGDGT 42 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5328.13493.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5328.13493.1 >prot_L-elsbetiae_contig5328.13493.1 ID=prot_L-elsbetiae_contig5328.13493.1|Name=mRNA_L-elsbetiae_contig5328.13493.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=82bp LGLVDGSRVVALDGHQAQVKCLSIDSRGELLVSGDESGSICARLLHPRQSback to top mRNA from alignment at L-elsbetiae_contig5328:857..1699- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5328.13493.1 ID=mRNA_L-elsbetiae_contig5328.13493.1|Name=mRNA_L-elsbetiae_contig5328.13493.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=843bp|location=Sequence derived from alignment at L-elsbetiae_contig5328:857..1699- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5328:857..1699- >mRNA_L-elsbetiae_contig5328.13493.1 ID=mRNA_L-elsbetiae_contig5328.13493.1|Name=mRNA_L-elsbetiae_contig5328.13493.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=492bp|location=Sequence derived from alignment at L-elsbetiae_contig5328:857..1699- (Laminarionema elsbetiae ELsaHSoW15)back to top |