mRNA_L-elsbetiae_contig530.13457.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig530.13457.1 vs. uniprot
Match: D7FT11_ECTSI (EsV-1-1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT11_ECTSI) HSP 1 Score: 52.4 bits (124), Expect = 3.810e-5 Identity = 37/75 (49.33%), Postives = 45/75 (60.00%), Query Frame = 2 Query: 92 PKVVRMLVEAGADTATAVQLRITPGGKIRFNVTPLALTNLYLRTSKSATCNASGKALHTEEELNELEGTRRLLLQ 316 P++VRMLV+AGADT + VQ+ GG + FN TPLA T L LR A GK T+E L LE RLLL+ Sbjct: 398 PRIVRMLVDAGADTTSPVQVMNLKGGVV-FNDTPLAFTKLRLRKK----IVADGKPA-TKEHLQRLEAICRLLLR 466
BLAST of mRNA_L-elsbetiae_contig530.13457.1 vs. uniprot
Match: D8LSC5_ECTSI (EsV-1-199 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSC5_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 6.440e-5 Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 2 Query: 92 PKVVRMLVEAGADTATAVQLRITPGGKIRFNVTPLALTNLYLRTSKSATCNASGKALHTEEELNELEGTRRLLLQ 316 P++VR+LV+AGADT + V++ GG + +N TPLA+T LR GK TEE+L+ L+ RRLLL+ Sbjct: 78 PRIVRLLVDAGADTTSTVRVTNLNGG-VEYNDTPLAVTTSLLREKV-----VDGKPA-TEEQLHRLQAIRRLLLR 145 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig530.13457.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig530.13457.1 >prot_L-elsbetiae_contig530.13457.1 ID=prot_L-elsbetiae_contig530.13457.1|Name=mRNA_L-elsbetiae_contig530.13457.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=103bp MLVEAGADTATAVQLRITPGGKIRFNVTPLALTNLYLRTSKSATCNASGKback to top mRNA from alignment at L-elsbetiae_contig530:12226..13256+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig530.13457.1 ID=mRNA_L-elsbetiae_contig530.13457.1|Name=mRNA_L-elsbetiae_contig530.13457.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1031bp|location=Sequence derived from alignment at L-elsbetiae_contig530:12226..13256+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig530:12226..13256+ >mRNA_L-elsbetiae_contig530.13457.1 ID=mRNA_L-elsbetiae_contig530.13457.1|Name=mRNA_L-elsbetiae_contig530.13457.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=618bp|location=Sequence derived from alignment at L-elsbetiae_contig530:12226..13256+ (Laminarionema elsbetiae ELsaHSoW15)back to top |