mRNA_L-elsbetiae_contig5213.13316.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5213.13316.1 vs. uniprot
Match: D7FZW0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZW0_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 7.090e-22 Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 3 Query: 3 YACYAELPSDMRPHAGDVLAFKTLSLNEETWTPELSAYRTAQVAAFDTSSSIVRVFPVSVEDD 191 Y Y ELP+DMRP DVLAFKTLSLNEETWTPELS YRTA+V AFDTSS +VR+ P S+EDD Sbjct: 176 YVVYEELPTDMRPQVCDVLAFKTLSLNEETWTPELSPYRTAEVTAFDTSSGLVRLLPASIEDD 238
BLAST of mRNA_L-elsbetiae_contig5213.13316.1 vs. uniprot
Match: A0A6H5L4H0_9PHAE (Coilin n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4H0_9PHAE) HSP 1 Score: 94.4 bits (233), Expect = 6.760e-20 Identity = 48/73 (65.75%), Postives = 52/73 (71.23%), Query Frame = 3 Query: 3 YACYAELPSDMRPHAGDVLAFKTLSLNEETWTPELSAYRTAQVAAFDTSSSIVRVFPVSVEDDKVLRGDASGG 221 Y Y ELP+DMRP DVLAFKTLSLNEETWTPELS YR A+V AFD SS +VR+ P S EDD G A G Sbjct: 637 YVGYEELPTDMRPQVRDVLAFKTLSLNEETWTPELSPYRMAEVIAFDASSGLVRLRPASTEDDNKDGGGAGSG 709 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5213.13316.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5213.13316.1 >prot_L-elsbetiae_contig5213.13316.1 ID=prot_L-elsbetiae_contig5213.13316.1|Name=mRNA_L-elsbetiae_contig5213.13316.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=131bp MPATRSSPATCARTQGTCSPSRPCPSTRKPGRRSSRPIARRRWPPSTRLPback to top mRNA from alignment at L-elsbetiae_contig5213:1073..2417+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5213.13316.1 ID=mRNA_L-elsbetiae_contig5213.13316.1|Name=mRNA_L-elsbetiae_contig5213.13316.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1345bp|location=Sequence derived from alignment at L-elsbetiae_contig5213:1073..2417+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5213:1073..2417+ >mRNA_L-elsbetiae_contig5213.13316.1 ID=mRNA_L-elsbetiae_contig5213.13316.1|Name=mRNA_L-elsbetiae_contig5213.13316.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=786bp|location=Sequence derived from alignment at L-elsbetiae_contig5213:1073..2417+ (Laminarionema elsbetiae ELsaHSoW15)back to top |