mRNA_L-elsbetiae_contig496.12933.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig496.12933.1 vs. uniprot
Match: D8LBE8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBE8_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 9.690e-12 Identity = 29/36 (80.56%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 250 QKEEFPLTSTPLDTWVGRYVRITSPKHNGTTGLVHR 357 +K+EFPL S PLDTWVGR+VRIT+P+HNGTTGLVHR Sbjct: 79 RKDEFPLISVPLDTWVGRFVRITTPRHNGTTGLVHR 114
BLAST of mRNA_L-elsbetiae_contig496.12933.1 vs. uniprot
Match: A0A6H5JHP0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHP0_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 1.280e-11 Identity = 29/35 (82.86%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 253 KEEFPLTSTPLDTWVGRYVRITSPKHNGTTGLVHR 357 K+EFPL S PLDTWVGR+VRIT+P+HNGTTGLVHR Sbjct: 104 KDEFPLISVPLDTWVGRFVRITTPRHNGTTGLVHR 138 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig496.12933.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig496.12933.1 >prot_L-elsbetiae_contig496.12933.1 ID=prot_L-elsbetiae_contig496.12933.1|Name=mRNA_L-elsbetiae_contig496.12933.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=119bp AVNERPTAHASAPLANASAAPGGGDATHGEGGSESPGPAAERDGEGGSGRback to top mRNA from alignment at L-elsbetiae_contig496:34051..35085- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig496.12933.1 ID=mRNA_L-elsbetiae_contig496.12933.1|Name=mRNA_L-elsbetiae_contig496.12933.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1035bp|location=Sequence derived from alignment at L-elsbetiae_contig496:34051..35085- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig496:34051..35085- >mRNA_L-elsbetiae_contig496.12933.1 ID=mRNA_L-elsbetiae_contig496.12933.1|Name=mRNA_L-elsbetiae_contig496.12933.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=714bp|location=Sequence derived from alignment at L-elsbetiae_contig496:34051..35085- (Laminarionema elsbetiae ELsaHSoW15)back to top |