mRNA_L-elsbetiae_contig208.6287.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig208.6287.1 vs. uniprot
Match: D7FS39_ECTSI (AAA domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS39_ECTSI) HSP 1 Score: 51.2 bits (121), Expect = 8.520e-5 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 3 Query: 3 SEDCELTEGMWANTERQKIEEFSTKVSMTAAAA 101 SEDCELTE +WA+TERQK++EFS K+ +TA AA Sbjct: 840 SEDCELTEALWASTERQKLKEFSEKLVLTATAA 872 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig208.6287.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig208.6287.1 >prot_L-elsbetiae_contig208.6287.1 ID=prot_L-elsbetiae_contig208.6287.1|Name=mRNA_L-elsbetiae_contig208.6287.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=124bp MWANTERQKIEEFSTKVSMTAAAAATAAAAAPAIGNAAIDVGSRVKSINEback to top mRNA from alignment at L-elsbetiae_contig208:43126..43526+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig208.6287.1 ID=mRNA_L-elsbetiae_contig208.6287.1|Name=mRNA_L-elsbetiae_contig208.6287.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=401bp|location=Sequence derived from alignment at L-elsbetiae_contig208:43126..43526+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig208:43126..43526+ >mRNA_L-elsbetiae_contig208.6287.1 ID=mRNA_L-elsbetiae_contig208.6287.1|Name=mRNA_L-elsbetiae_contig208.6287.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=744bp|location=Sequence derived from alignment at L-elsbetiae_contig208:43126..43526+ (Laminarionema elsbetiae ELsaHSoW15)back to top |