mRNA_L-elsbetiae_contig20742.6257.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20742.6257.1 vs. uniprot
Match: D7G857_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G857_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 7.110e-12 Identity = 28/40 (70.00%), Postives = 37/40 (92.50%), Query Frame = 1 Query: 1 LCLLLIMRDEEENLKKHLPVWRDVADCFVVGVDDRTTDST 120 LCLL+I+RDEE +L ++LP+W DVADCFV+GVDDRT+D+T Sbjct: 84 LCLLMIVRDEEFSLSENLPLWLDVADCFVIGVDDRTSDAT 123
BLAST of mRNA_L-elsbetiae_contig20742.6257.1 vs. uniprot
Match: A0A7S3JQU4_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3JQU4_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.040e-6 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 LCLLLIMRDEEENLKKHLPVWRDVADCFVVGVDDRTTDSTA 123 LC+LL+MRDEEE +++HL W DVA C V +D+RT D +A Sbjct: 13 LCVLLLMRDEEELIREHLSSWLDVAWCTVGAIDERTRDHSA 53 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20742.6257.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig20742.6257.1 >prot_L-elsbetiae_contig20742.6257.1 ID=prot_L-elsbetiae_contig20742.6257.1|Name=mRNA_L-elsbetiae_contig20742.6257.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=35bp MRDEEENLKKHLPVWRDVADCFVVGVDDRTTDSTAback to top mRNA from alignment at L-elsbetiae_contig20742:1071..1193- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig20742.6257.1 ID=mRNA_L-elsbetiae_contig20742.6257.1|Name=mRNA_L-elsbetiae_contig20742.6257.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=123bp|location=Sequence derived from alignment at L-elsbetiae_contig20742:1071..1193- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig20742:1071..1193- >mRNA_L-elsbetiae_contig20742.6257.1 ID=mRNA_L-elsbetiae_contig20742.6257.1|Name=mRNA_L-elsbetiae_contig20742.6257.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=210bp|location=Sequence derived from alignment at L-elsbetiae_contig20742:1071..1193- (Laminarionema elsbetiae ELsaHSoW15)back to top |